PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ciclev10021911m | ||||||||
Common Name | CICLE_v10021911mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 245aa MW: 27757.6 Da PI: 9.3356 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 100.2 | 8.1e-32 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krienk+nrqvtfskRrng+lKKA+ELSvLCdaeva+iifss+gklye+ Ciclev10021911m 9 KRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFG 58 79**********************************************95 PP | |||||||
2 | K-box | 103 | 3.9e-34 | 81 | 170 | 10 | 99 |
K-box 10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 e++++s++qe++kLk+++e+Lqr+qRhllGedL++Ls+keLq+Le+qLe +l R++K+++++eq+e+l+kke++l ++nk+Lr kle Ciclev10021911m 81 IERETQSWYQEATKLKAKYESLQRTQRHLLGEDLGPLSVKELQNLEKQLEGALALARQRKTQIMIEQVEDLRKKERQLGDINKQLRIKLE 170 46789*********************************************************************************9987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 33.571 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.8E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 8.18E-45 | 2 | 72 | No hit | No description |
SuperFamily | SSF55455 | 1.12E-33 | 2 | 83 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.9E-33 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.9E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.9E-33 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.9E-33 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 2.3E-30 | 82 | 169 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 16.828 | 85 | 175 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009553 | Biological Process | embryo sac development | ||||
GO:0009911 | Biological Process | positive regulation of flower development | ||||
GO:0010094 | Biological Process | specification of carpel identity | ||||
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048455 | Biological Process | stamen formation | ||||
GO:0048459 | Biological Process | floral whorl structural organization | ||||
GO:0048509 | Biological Process | regulation of meristem development | ||||
GO:0048833 | Biological Process | specification of floral organ number | ||||
GO:0080060 | Biological Process | integument development | ||||
GO:0080112 | Biological Process | seed growth | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 245 aa Download sequence Send to blast |
MGRGRVELKR IENKINRQVT FSKRRNGLLK KAYELSVLCD AEVALIIFSS RGKLYEFGSA 60 GINKTLERYQ RCCFNPQDNS IERETQSWYQ EATKLKAKYE SLQRTQRHLL GEDLGPLSVK 120 ELQNLEKQLE GALALARQRK TQIMIEQVED LRKKERQLGD INKQLRIKLE TEGQSFKAIQ 180 DLWNSAAAGA GNSNFSVHPS HDSPMNCDPE PALQIGYLNY LPSEGSSVPK NTVGETNFIQ 240 GWVL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4ox0_A | 4e-23 | 87 | 169 | 19 | 101 | Developmental protein SEPALLATA 3 |
4ox0_B | 4e-23 | 87 | 169 | 19 | 101 | Developmental protein SEPALLATA 3 |
4ox0_C | 4e-23 | 87 | 169 | 19 | 101 | Developmental protein SEPALLATA 3 |
4ox0_D | 4e-23 | 87 | 169 | 19 | 101 | Developmental protein SEPALLATA 3 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and seeds. {ECO:0000269|Ref.1}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00315 | DAP | Transfer from AT2G45650 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FJ409870 | 1e-149 | FJ409870.1 Gossypium hirsutum MADS-13 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006445200.1 | 0.0 | agamous-like MADS-box protein AGL6 isoform X1 | ||||
Refseq | XP_006490967.1 | 0.0 | agamous-like MADS-box protein AGL6 isoform X1 | ||||
Swissprot | Q8LLR1 | 1e-150 | MADS3_VITVI; Agamous-like MADS-box protein MADS3 | ||||
TrEMBL | A0A067HDD8 | 1e-180 | A0A067HDD8_CITSI; Uncharacterized protein | ||||
TrEMBL | A0A2H5NPE7 | 1e-180 | A0A2H5NPE7_CITUN; Uncharacterized protein | ||||
TrEMBL | V4U2Z7 | 1e-180 | V4U2Z7_9ROSI; Uncharacterized protein | ||||
STRING | XP_006490967.1 | 0.0 | (Citrus sinensis) | ||||
STRING | XP_006445200.1 | 0.0 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4302 | 26 | 54 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45650.1 | 1e-118 | AGAMOUS-like 6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Ciclev10021911m |
Entrez Gene | 18046726 |
Publications ? help Back to Top | |||
---|---|---|---|
|