PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ciclev10017004m | ||||||||
Common Name | CICLE_v10016820mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 165aa MW: 19025.1 Da PI: 10.5592 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.4 | 1.4e-17 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT eEd++l+++++ +G g W++ a+ g++Rt+k+c++rw++yl Ciclev10017004m 15 KGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYL 62 79********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 8.8E-25 | 7 | 65 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 21.561 | 10 | 66 | IPR017930 | Myb domain |
SMART | SM00717 | 7.2E-13 | 14 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.7E-16 | 15 | 62 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 9.8E-23 | 16 | 93 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.73E-10 | 17 | 62 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.3E-8 | 66 | 96 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009740 | Biological Process | gibberellic acid mediated signaling pathway | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0080086 | Biological Process | stamen filament development | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 165 aa Download sequence Send to blast |
MDKTPCNSQE AEVRKGPWTM EEDLILINYI ANHGEGVWNS LAKAAGLKRT GKSCRLRWLN 60 YLRPDVKRGN ITPEEQLLIM ELHAKWGNRL VYIYKTTGGP KLQSIYQEGP TMKLRIFGEP 120 ESRSKLSKQK HFQGKVQRPM SKQAQAKCPL LHTRWKIIQH HNIH* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 7e-15 | 12 | 99 | 24 | 110 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Ccl.2231 | 0.0 | flower |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: First detected in 15-20 mm buds. Expression increases as flowers develop. {ECO:0000269|PubMed:1840903}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed only in flowers. {ECO:0000269|PubMed:1840903}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. {ECO:0000305}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006446526.1 | 1e-121 | myb-related protein 305 isoform X2 | ||||
Swissprot | P81391 | 9e-60 | MYB05_ANTMA; Myb-related protein 305 | ||||
TrEMBL | V4UC01 | 1e-119 | V4UC01_9ROSI; Uncharacterized protein | ||||
STRING | XP_006470308.1 | 2e-60 | (Citrus sinensis) | ||||
STRING | XP_006446527.1 | 3e-60 | (Citrus clementina) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G27810.1 | 1e-54 | myb domain protein 21 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Ciclev10017004m |
Entrez Gene | 18051076 |
Publications ? help Back to Top | |||
---|---|---|---|
|