PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ciclev10016937m | ||||||||
Common Name | CICLE_v10016841mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 174aa MW: 19064.4 Da PI: 9.1923 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 75 | 1.2e-23 | 65 | 111 | 2 | 48 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 Cqv++C+adls+ak+yhrrhkvCevh+ka+vvl+ g++qrfCqqCsr Ciclev10016937m 65 CQVDKCAADLSDAKQYHRRHKVCEVHAKAQVVLMGGMRQRFCQQCSR 111 **********************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 6.3E-24 | 57 | 111 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 20.683 | 62 | 123 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 6.93E-26 | 64 | 126 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 2.5E-17 | 65 | 118 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 174 aa Download sequence Send to blast |
MDAKRKNKMV KVLKKEEATA AFVDSDDDDD GGEYDLCPQE EGDDNRNSGS KKKKGSSGGS 60 GLRSCQVDKC AADLSDAKQY HRRHKVCEVH AKAQVVLMGG MRQRFCQQCS RRLAGHNERR 120 RKNAAESNGE GSSCKGTGTG TQLKDLVCGK LDDKGRIKIS IQENATCKHF QIR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 1e-28 | 55 | 122 | 1 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Increases during floral transition and stay high thereafter. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:14573523}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the rib meristem and inter-primordial tissue of the inflorescence apex. {ECO:0000269|PubMed:10524240}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16914499}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00634 | PBM | Transfer from PK22320.1 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040, ECO:0000305|PubMed:16914499}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006469892.1 | 1e-101 | squamosa promoter-binding protein 1-like | ||||
Refseq | XP_024047844.1 | 1e-101 | squamosa promoter-binding protein 1 | ||||
Swissprot | Q9S7A9 | 4e-29 | SPL4_ARATH; Squamosa promoter-binding-like protein 4 | ||||
TrEMBL | V4W3D8 | 1e-122 | V4W3D8_9ROSI; Uncharacterized protein | ||||
STRING | XP_006469892.1 | 1e-101 | (Citrus sinensis) | ||||
STRING | XP_006447265.1 | 1e-101 | (Citrus clementina) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G53160.2 | 3e-30 | squamosa promoter binding protein-like 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Ciclev10016937m |
Entrez Gene | 18052841 |