PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | C.cajan_36768 | ||||||||
Common Name | KK1_041221 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 159aa MW: 18412.2 Da PI: 5.0993 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 98.7 | 3.6e-31 | 98 | 155 | 1 | 58 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 ldDg++WrKYG+K+vk+s++pr+YY+C+ gCpvkk+ver+++dp++v +tYeg H+h C.cajan_36768 98 LDDGFKWRKYGKKMVKNSPNPRNYYKCSVDGCPVKKRVERDKDDPSYVLTTYEGIHTH 155 59******************************************************** PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.3E-32 | 85 | 155 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.11E-27 | 91 | 155 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.483 | 93 | 155 | IPR003657 | WRKY domain |
SMART | SM00774 | 3.7E-36 | 98 | 157 | IPR003657 | WRKY domain |
Pfam | PF03106 | 8.7E-25 | 99 | 155 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 159 aa Download sequence Send to blast |
MTDKNLRPPD SSDSGFTNQW PLEVSEYFYF DDDDDPTDSF VFGHVLSQDN QANEVGDFKG 60 TRASHFEGFS SREVGNEHEK KEVNDRVAFK TKSEVEILDD GFKWRKYGKK MVKNSPNPRN 120 YYKCSVDGCP VKKRVERDKD DPSYVLTTYE GIHTHLSYC |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 8e-25 | 88 | 155 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 8e-25 | 88 | 155 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00531 | DAP | Transfer from AT5G26170 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | C.cajan_36768 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015035 | 6e-43 | AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020204712.1 | 1e-116 | probable WRKY transcription factor 50 | ||||
TrEMBL | A0A151R504 | 1e-115 | A0A151R504_CAJCA; Putative WRKY transcription factor 50 | ||||
STRING | GLYMA04G05700.1 | 9e-79 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1120 | 34 | 110 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 7e-45 | WRKY DNA-binding protein 50 |