PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | C.cajan_23947 | ||||||||
Common Name | KK1_024746 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 125aa MW: 14724.5 Da PI: 9.4585 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 133 | 9.8e-42 | 3 | 78 | 1 | 76 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 +Cqve+C+adl eak+yhrrh+vCe h+ka+vvlv+g++qrfCqqCsrfhel efD++krsCrrrLa+hnerrrk+ C.cajan_23947 3 CCQVEKCNADLHEAKQYHRRHRVCEYHAKAQVVLVDGVRQRFCQQCSRFHELAEFDDTKRSCRRRLAGHNERRRKN 78 6*************************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51141 | 32.24 | 1 | 78 | IPR004333 | Transcription factor, SBP-box |
Gene3D | G3DSA:4.10.1100.10 | 2.4E-32 | 2 | 65 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 5.76E-38 | 2 | 80 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 1.9E-33 | 4 | 77 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 125 aa Download sequence Send to blast |
MRCCQVEKCN ADLHEAKQYH RRHRVCEYHA KAQVVLVDGV RQRFCQQCSR FHELAEFDDT 60 KRSCRRRLAG HNERRRKNGD QSQAEGSSRK GTGTPQLKDI ACGQADERER IQLQENAPYK 120 HFQIR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 7e-36 | 1 | 77 | 8 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16914499}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00634 | PBM | Transfer from PK22320.1 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | C.cajan_23947 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040, ECO:0000305|PubMed:16914499}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020229499.1 | 2e-87 | squamosa promoter-binding-like protein 4 | ||||
Swissprot | Q9S7A9 | 1e-41 | SPL4_ARATH; Squamosa promoter-binding-like protein 4 | ||||
TrEMBL | A0A151SF51 | 3e-86 | A0A151SF51_CAJCA; Squamosa promoter-binding-like protein 4 | ||||
STRING | GLYMA13G37130.1 | 2e-66 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF535 | 34 | 153 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G53160.2 | 5e-44 | squamosa promoter binding protein-like 4 |