PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | C.cajan_07729 | ||||||||
Common Name | KK1_007942 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 176aa MW: 20490 Da PI: 9.8311 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 69.4 | 3.3e-22 | 24 | 70 | 4 | 50 |
-SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 + sn+qvtfskRr+g++KKA+EL++LC++ +a+i+fs+ +kl+ +s C.cajan_07729 24 DKASNKQVTFSKRRTGLFKKASELCILCNVYAAIIVFSPADKLFIFS 70 6789***************************************9987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.2E-30 | 13 | 72 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 24.586 | 13 | 73 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.18E-31 | 14 | 89 | No hit | No description |
SuperFamily | SSF55455 | 1.7E-26 | 14 | 87 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-19 | 15 | 35 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.4E-21 | 25 | 69 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-19 | 35 | 50 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-19 | 50 | 71 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 176 aa Download sequence Send to blast |
MDMLNQKKKK INTGRKKIEI KKLDKASNKQ VTFSKRRTGL FKKASELCIL CNVYAAIIVF 60 SPADKLFIFS HPDIDTILTR YVKGTAESEP TKSRGKTVSY EEHNMQYEEA KKKLEMEKKI 120 LEETEMLAKT CNGNLWWNQP VDQILDDQLE PFMVAVYELR KKLAERATQL MMFGMQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6bz1_A | 2e-19 | 14 | 101 | 2 | 86 | MEF2 CHIMERA |
6bz1_B | 2e-19 | 14 | 101 | 2 | 86 | MEF2 CHIMERA |
6bz1_C | 2e-19 | 14 | 101 | 2 | 86 | MEF2 CHIMERA |
6bz1_D | 2e-19 | 14 | 101 | 2 | 86 | MEF2 CHIMERA |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | C.cajan_07729 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020233147.1 | 1e-129 | agamous-like MADS-box protein AGL61 | ||||
TrEMBL | A0A151U7E1 | 1e-128 | A0A151U7E1_CAJCA; Agamous-like MADS-box protein AGL62 | ||||
STRING | GLYMA20G27361.1 | 8e-80 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF128 | 33 | 331 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G24840.1 | 5e-26 | AGAMOUS-like 61 |