PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa34577s010.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | BBR-BPC | ||||||||
Protein Properties | Length: 70aa MW: 7589.73 Da PI: 10.6376 | ||||||||
Description | BBR-BPC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GAGA_bind | 152.2 | 9e-47 | 1 | 70 | 227 | 296 |
GAGA_bind 227 nGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnk 296 +GGWqS+CCt++iS+yPLP+st+r+gaR+agrKmS+ga+ klL++La+eGy+ls+pvDLk+hWA+HGtnk Csa34577s010.1 1 MGGWQSSCCTISISTYPLPMSTTRPGARLAGRKMSNGAYVKLLARLAGEGYSLSHPVDLKNHWARHGTNK 70 6********************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01226 | 2.7E-6 | 1 | 70 | IPR010409 | GAGA-binding transcriptional activator |
Pfam | PF06217 | 7.0E-41 | 2 | 70 | IPR010409 | GAGA-binding transcriptional activator |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 70 aa Download sequence Send to blast |
MGGWQSSCCT ISISTYPLPM STTRPGARLA GRKMSNGAYV KLLARLAGEG YSLSHPVDLK 60 NHWARHGTNK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa34577s010.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU089961 | 7e-90 | EU089961.1 Arabidopsis arenosa GAGA-binding transcriptional activator (BBR/BPC7) gene, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010516733.1 | 2e-45 | PREDICTED: protein BASIC PENTACYSTEINE7 | ||||
Swissprot | O82286 | 1e-44 | BPC7_ARATH; Protein BASIC PENTACYSTEINE7 | ||||
TrEMBL | R0HUS9 | 3e-43 | R0HUS9_9BRAS; Uncharacterized protein | ||||
STRING | XP_010516733.1 | 8e-45 | (Camelina sativa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G35550.4 | 5e-47 | basic pentacysteine 7 |