PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Csa34253s010.1

Organism

Camelina sativa

Taxonomic ID

90675

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina

Family

NAC

Protein Properties

Length: 65aa MW: 7449.54 Da PI: 4.629

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Csa34253s010.1	genome	CSGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	54.3	4.6e-17	16	62	1	48
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48 +ppGfrFhPt+eel+++yL+kkv++ +++l +vi++vd++k+ePwd++ Csa34253s010.1 16 VPPGFRFHPTEEELLQYYLRKKVNSIEIDL-DVIRDVDLNKLEPWDIQ 62 69**************************.99***********96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	3.4E-18	9	63	IPR003441	NAC domain
PROSITE profile	PS51005	19.939	16	64	IPR003441	NAC domain
Pfam	PF02365	2.0E-8	17	59	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 65 aa Download sequence Send to blast
MMSKSMSISV NGQSQVPPGF RFHPTEEELL QYYLRKKVNS IEIDLDVIRD VDLNKLEPWD 60 IQGL*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269\|PubMed:16214898, ECO:0000269\|PubMed:17237351, ECO:0000269\|PubMed:17333250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Csa34253s010.1

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC005310	1e-91	AC005310.3 Arabidopsis thaliana chromosome 2 clone F19D11 map CIC06C03, complete sequence.
GenBank	CP002685	1e-91	CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002882089.2	8e-37	NAC domain-containing protein 43
Swissprot	Q84WP6	9e-38	NAC43_ARATH; NAC domain-containing protein 43
TrEMBL	A0A078K4H5	1e-35	A0A078K4H5_BRANA; BnaAnng41940D protein
TrEMBL	A0A1J3GEF5	6e-36	A0A1J3GEF5_NOCCA; NAC domain-containing protein 43 (Fragment)
TrEMBL	D4HU13	1e-35	D4HU13_ARAHH; Embryo defective 2301 EMB2301
STRING	Cagra.0050s0024.1.p	4e-36	(Capsella grandiflora)
STRING	AT2G46770.1	4e-36	(Arabidopsis thaliana)
STRING	Bostr.25993s0090.1.p	5e-36	(Boechera stricta)
STRING	XP_006293486.1	4e-36	(Capsella rubella)
STRING	XP_010507974.1	4e-36	(Camelina sativa)
STRING	XP_010518355.1	4e-36	(Camelina sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM7967	13	40

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G46770.1	4e-40	NAC family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Gondolf VM, et al. A gene stacking approach leads to engineered plants with highly increased galactan levels in Arabidopsis. BMC Plant Biol., 2014. 14: p. 344 [PMID:25492673] Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons. GM Crops Food, 2014. 5(4): p. 302-20 [PMID:25523176] Yuan Y,Teng Q,Zhong R,Ye ZH TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan. Plant Cell Physiol., 2016. 57(1): p. 35-45 [PMID:26556650] Yang C, et al. Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation. Plant Physiol., 2017. 175(1): p. 333-350 [PMID:28724622] Pascual MB, et al. PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine. Plant Biotechnol. J., 2018. 16(5): p. 1094-1104 [PMID:29055073] Liu C,Yu H,Li L SUMO modification of LBD30 by SIZ1 regulates secondary cell wall formation in Arabidopsis thaliana. PLoS Genet., 2019. 15(1): p. e1007928 [PMID:30657769]