PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa16g007760.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 221aa MW: 25310.5 Da PI: 9.1805 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 163 | 1.1e-50 | 15 | 137 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 lppGfrFhPtdeelvv+yL++kv+g +l++ +vi+e+d++k++PwdLp ++e yfFs+++ ky++g+r+nr+t sgyWkatg dk++ + Csa16g007760.1 15 LPPGFRFHPTDEELVVQYLRRKVTGLPLPA-SVIPETDVCKSDPWDLPGD---CDSERYFFSTKEAKYPNGNRSNRSTGSGYWKATGIDKQIGK- 104 79****************************.99***************44...47899**********************************99. PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 k+ +vg+kktLvfykg+ p+g++t+Wv+heyrl Csa16g007760.1 105 KTLAVGMKKTLVFYKGKPPNGTRTNWVLHEYRL 137 8999***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 4.97E-61 | 10 | 160 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 56.596 | 15 | 160 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.0E-27 | 16 | 137 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 221 aa Download sequence Send to blast |
MEKRSTIKNR GVLRLPPGFR FHPTDEELVV QYLRRKVTGL PLPASVIPET DVCKSDPWDL 60 PGDCDSERYF FSTKEAKYPN GNRSNRSTGS GYWKATGIDK QIGKKTLAVG MKKTLVFYKG 120 KPPNGTRTNW VLHEYRLVDS QQESSHVQSM NWVLCRVFLK KRSNSNKRKE EERDDLENEK 180 ETEKERSSSS VCSSALTQTS SNDSYHEEIS CQENKFCLFL * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-55 | 13 | 167 | 15 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-55 | 13 | 167 | 15 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-55 | 13 | 167 | 15 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-55 | 13 | 167 | 15 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-55 | 13 | 167 | 18 | 174 | NAC domain-containing protein 19 |
3swm_B | 2e-55 | 13 | 167 | 18 | 174 | NAC domain-containing protein 19 |
3swm_C | 2e-55 | 13 | 167 | 18 | 174 | NAC domain-containing protein 19 |
3swm_D | 2e-55 | 13 | 167 | 18 | 174 | NAC domain-containing protein 19 |
3swp_A | 2e-55 | 13 | 167 | 18 | 174 | NAC domain-containing protein 19 |
3swp_B | 2e-55 | 13 | 167 | 18 | 174 | NAC domain-containing protein 19 |
3swp_C | 2e-55 | 13 | 167 | 18 | 174 | NAC domain-containing protein 19 |
3swp_D | 2e-55 | 13 | 167 | 18 | 174 | NAC domain-containing protein 19 |
4dul_A | 1e-55 | 13 | 167 | 15 | 171 | NAC domain-containing protein 19 |
4dul_B | 1e-55 | 13 | 167 | 15 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa16g007760.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF325080 | 0.0 | AF325080.1 Arabidopsis thaliana putative NAM (no apical meristem)-like protein (At2g33480) mRNA, complete cds. | |||
GenBank | AF410299 | 0.0 | AF410299.1 Arabidopsis thaliana At2g33480/F4P9.25 mRNA, complete cds. | |||
GenBank | AY093730 | 0.0 | AY093730.1 Arabidopsis thaliana At2g33480/F4P9.25 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010469465.1 | 1e-140 | PREDICTED: NAC domain-containing protein 41-like | ||||
Swissprot | Q9FY93 | 2e-80 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
TrEMBL | R0HQU6 | 1e-113 | R0HQU6_9BRAS; Uncharacterized protein | ||||
STRING | XP_010469465.1 | 1e-139 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1806 | 27 | 86 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G33480.1 | 1e-114 | NAC domain containing protein 41 |
Publications ? help Back to Top | |||
---|---|---|---|
|