PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT2G33480.1 | ||||||||
Common Name | ANAC041, NAC041 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 268aa MW: 31124.3 Da PI: 9.5098 | ||||||||
Description | NAC domain containing protein 41 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 163.9 | 5.9e-51 | 15 | 137 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 lppGfrFhPtdeelvv+yL++kv+g +l++ +vi+e+d++k++PwdLp e+e+yfFs+r+ ky++g+r+nr+t sgyWkatg dk++ + k+ AT2G33480.1 15 LPPGFRFHPTDEELVVQYLRRKVTGLPLPA-SVIPETDVCKSDPWDLPGD---CESEMYFFSTREAKYPNGNRSNRSTGSGYWKATGLDKQIGK-KKL 107 79****************************.99***************44...4679***********************************99.999 PP NAM 99 lvglkktLvfykgrapkgektdWvmheyrl 128 +vg+kktLvfykg+ p+g++t+Wv+heyrl AT2G33480.1 108 VVGMKKTLVFYKGKPPNGTRTNWVLHEYRL 137 9***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.01E-61 | 10 | 160 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 56.686 | 15 | 160 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.8E-27 | 16 | 137 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0007275 | Biological Process | multicellular organism development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020038 | anatomy | petiole | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 268 aa Download sequence Send to blast |
MEKRSSIKNR GVLRLPPGFR FHPTDEELVV QYLRRKVTGL PLPASVIPET DVCKSDPWDL 60 PGDCESEMYF FSTREAKYPN GNRSNRSTGS GYWKATGLDK QIGKKKLVVG MKKTLVFYKG 120 KPPNGTRTNW VLHEYRLVDS QQDSLYGQNM NWVLCRVFLK KRSNSNSKRK EDEKEEVENE 180 KETETERERE EENKKSTCPI FYDFMRKDTK KKRRRRRCCD LNLTPATCCC CSSSTSSSSV 240 CSSALTHTSS NDNRQEISYR ENKFCLFL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 6e-54 | 13 | 163 | 15 | 168 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 6e-54 | 13 | 163 | 15 | 168 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 6e-54 | 13 | 163 | 15 | 168 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 6e-54 | 13 | 163 | 15 | 168 | NO APICAL MERISTEM PROTEIN |
3swm_A | 7e-54 | 13 | 163 | 18 | 171 | NAC domain-containing protein 19 |
3swm_B | 7e-54 | 13 | 163 | 18 | 171 | NAC domain-containing protein 19 |
3swm_C | 7e-54 | 13 | 163 | 18 | 171 | NAC domain-containing protein 19 |
3swm_D | 7e-54 | 13 | 163 | 18 | 171 | NAC domain-containing protein 19 |
3swp_A | 7e-54 | 13 | 163 | 18 | 171 | NAC domain-containing protein 19 |
3swp_B | 7e-54 | 13 | 163 | 18 | 171 | NAC domain-containing protein 19 |
3swp_C | 7e-54 | 13 | 163 | 18 | 171 | NAC domain-containing protein 19 |
3swp_D | 7e-54 | 13 | 163 | 18 | 171 | NAC domain-containing protein 19 |
4dul_A | 6e-54 | 13 | 163 | 15 | 168 | NAC domain-containing protein 19 |
4dul_B | 6e-54 | 13 | 163 | 15 | 168 | NAC domain-containing protein 19 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 209 | 214 | KKKRRR |
2 | 210 | 216 | KKRRRRR |
3 | 211 | 216 | KRRRRR |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.47520 | 0.0 | leaf| root| seed| silique |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 145360577 | 0.0 | ||||
Genevisible | 255794_at | 0.0 | ||||
Expression Atlas | AT2G33480 | - | ||||
AtGenExpress | AT2G33480 | - | ||||
ATTED-II | AT2G33480 | - |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator of the mannan synthase CSLA9. Recognizes and binds to DNA-specific sequence of CSLA9 promoter. {ECO:0000269|PubMed:24243147}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT2G33480.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
BioGRID | AT3G02150, AT5G13180 | |||||
IntAct | Search O22798 |
Phenotype -- Disruption Phenotype ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DISRUPTION PHENOTYPE: No visible phenotype under normal growth conditions. {ECO:0000269|PubMed:24243147}. |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT2G33480 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF325080 | 0.0 | AF325080.1 Arabidopsis thaliana putative NAM (no apical meristem)-like protein (At2g33480) mRNA, complete cds. | |||
GenBank | AF410299 | 0.0 | AF410299.1 Arabidopsis thaliana At2g33480/F4P9.25 mRNA, complete cds. | |||
GenBank | AY093730 | 0.0 | AY093730.1 Arabidopsis thaliana At2g33480/F4P9.25 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_180906.1 | 0.0 | NAC domain containing protein 41 | ||||
Swissprot | O22798 | 0.0 | NAC41_ARATH; NAC domain-containing protein 41 | ||||
TrEMBL | A0A178VTD8 | 0.0 | A0A178VTD8_ARATH; NAC041 | ||||
STRING | AT2G33480.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1806 | 27 | 86 | Representative plant | OGRP17 | 15 | 800 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT2G33480.1 |
Entrez Gene | 817913 |
iHOP | AT2G33480 |
wikigenes | AT2G33480 |