PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa14271s010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family NF-YB
Protein Properties Length: 96aa    MW: 10810.3 Da    PI: 5.239
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa14271s010.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB154.91.4e-481811797
           NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
                    mkk+lPanakiskdaket+qecvsefisfvt+easdkcq+ekrktingddllwa++tlGfedyveplkvyl+++re+ege+
  Csa14271s010.1  1 MKKALPANAKISKDAKETMQECVSEFISFVTGEASDKCQKEKRKTINGDDLLWAMTTLGFEDYVEPLKVYLQRFREIEGER 81
                    9******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008083.2E-22155IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471131.77E-33189IPR009072Histone-fold
Gene3DG3DSA:1.10.20.101.7E-43183IPR009072Histone-fold
PRINTSPR006151.9E-211937No hitNo description
PROSITE patternPS0068502238IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.9E-213856No hitNo description
PRINTSPR006151.9E-215775No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
MKKALPANAK ISKDAKETMQ ECVSEFISFV TGEASDKCQK EKRKTINGDD LLWAMTTLGF  60
EDYVEPLKVY LQRFREIEGE RTGLGRPQTG GEPGEH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B9e-381761792Transcription factor HapC (Eurofung)
4g92_B9e-381761792Transcription factor HapC (Eurofung)
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa14271s010.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0256281e-129AB025628.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MNJ7.
GenBankAF3857441e-129AF385744.1 Arabidopsis thaliana AT5g47640/MNJ7_23 mRNA, complete cds.
GenBankAY0780261e-129AY078026.1 Arabidopsis thaliana AT5g47640/MNJ7_23 mRNA, complete cds.
GenBankCP0026881e-129CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBankY137241e-129Y13724.1 Arabidopsis thaliana mRNA for Hap3b transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010441427.11e-66PREDICTED: nuclear transcription factor Y subunit B-2-like
RefseqXP_010481289.11e-66PREDICTED: nuclear transcription factor Y subunit B-2-like
RefseqXP_010495002.11e-66PREDICTED: nuclear transcription factor Y subunit B-2-like isoform X1
RefseqXP_019098089.11e-66PREDICTED: nuclear transcription factor Y subunit B-2-like isoform X2
SwissprotQ9FGJ34e-66NFYB2_ARATH; Nuclear transcription factor Y subunit B-2
TrEMBLA0A078HTQ15e-64A0A078HTQ1_BRANA; BnaA09g18400D protein
TrEMBLA0A397XV655e-64A0A397XV65_BRACM; Uncharacterized protein
TrEMBLA0A3P6DUM05e-64A0A3P6DUM0_BRAOL; Uncharacterized protein
TrEMBLM4DLU25e-64M4DLU2_BRARP; Uncharacterized protein
TrEMBLV4N3P46e-64V4N3P4_EUTSA; Uncharacterized protein
TrEMBLW6DGI75e-64W6DGI7_BRANA; BnaC09g20320D protein
STRINGXP_010441427.16e-66(Camelina sativa)
STRINGXP_010481289.14e-66(Camelina sativa)
STRINGXP_010495002.14e-66(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25528229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47640.12e-68nuclear factor Y, subunit B2
Publications ? help Back to Top
  1. Hwang YH, et al.
    Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time.
    Plant Cell Rep., 2016. 35(4): p. 857-65
    [PMID:26754793]
  2. Xu F, et al.
    DELLA proteins physically interact with CONSTANS to regulate flowering under long days in Arabidopsis.
    FEBS Lett., 2016. 590(4): p. 541-9
    [PMID:26801684]
  3. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]
  4. Gnesutta N, et al.
    CONSTANS Imparts DNA Sequence Specificity to the Histone Fold NF-YB/NF-YC Dimer.
    Plant Cell, 2017. 29(6): p. 1516-1532
    [PMID:28526714]