PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa14271s010.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 96aa MW: 10810.3 Da PI: 5.239 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 154.9 | 1.4e-48 | 1 | 81 | 17 | 97 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 mkk+lPanakiskdaket+qecvsefisfvt+easdkcq+ekrktingddllwa++tlGfedyveplkvyl+++re+ege+ Csa14271s010.1 1 MKKALPANAKISKDAKETMQECVSEFISFVTGEASDKCQKEKRKTINGDDLLWAMTTLGFEDYVEPLKVYLQRFREIEGER 81 9******************************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF00808 | 3.2E-22 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
SuperFamily | SSF47113 | 1.77E-33 | 1 | 89 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 1.7E-43 | 1 | 83 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 1.9E-21 | 19 | 37 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 22 | 38 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.9E-21 | 38 | 56 | No hit | No description |
PRINTS | PR00615 | 1.9E-21 | 57 | 75 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 96 aa Download sequence Send to blast |
MKKALPANAK ISKDAKETMQ ECVSEFISFV TGEASDKCQK EKRKTINGDD LLWAMTTLGF 60 EDYVEPLKVY LQRFREIEGE RTGLGRPQTG GEPGEH |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 9e-38 | 1 | 76 | 17 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 9e-38 | 1 | 76 | 17 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa14271s010.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB025628 | 1e-129 | AB025628.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MNJ7. | |||
GenBank | AF385744 | 1e-129 | AF385744.1 Arabidopsis thaliana AT5g47640/MNJ7_23 mRNA, complete cds. | |||
GenBank | AY078026 | 1e-129 | AY078026.1 Arabidopsis thaliana AT5g47640/MNJ7_23 mRNA, complete cds. | |||
GenBank | CP002688 | 1e-129 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. | |||
GenBank | Y13724 | 1e-129 | Y13724.1 Arabidopsis thaliana mRNA for Hap3b transcription factor. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010441427.1 | 1e-66 | PREDICTED: nuclear transcription factor Y subunit B-2-like | ||||
Refseq | XP_010481289.1 | 1e-66 | PREDICTED: nuclear transcription factor Y subunit B-2-like | ||||
Refseq | XP_010495002.1 | 1e-66 | PREDICTED: nuclear transcription factor Y subunit B-2-like isoform X1 | ||||
Refseq | XP_019098089.1 | 1e-66 | PREDICTED: nuclear transcription factor Y subunit B-2-like isoform X2 | ||||
Swissprot | Q9FGJ3 | 4e-66 | NFYB2_ARATH; Nuclear transcription factor Y subunit B-2 | ||||
TrEMBL | A0A078HTQ1 | 5e-64 | A0A078HTQ1_BRANA; BnaA09g18400D protein | ||||
TrEMBL | A0A397XV65 | 5e-64 | A0A397XV65_BRACM; Uncharacterized protein | ||||
TrEMBL | A0A3P6DUM0 | 5e-64 | A0A3P6DUM0_BRAOL; Uncharacterized protein | ||||
TrEMBL | M4DLU2 | 5e-64 | M4DLU2_BRARP; Uncharacterized protein | ||||
TrEMBL | V4N3P4 | 6e-64 | V4N3P4_EUTSA; Uncharacterized protein | ||||
TrEMBL | W6DGI7 | 5e-64 | W6DGI7_BRANA; BnaC09g20320D protein | ||||
STRING | XP_010441427.1 | 6e-66 | (Camelina sativa) | ||||
STRING | XP_010481289.1 | 4e-66 | (Camelina sativa) | ||||
STRING | XP_010495002.1 | 4e-66 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM255 | 28 | 229 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47640.1 | 2e-68 | nuclear factor Y, subunit B2 |
Publications ? help Back to Top | |||
---|---|---|---|
|