PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa13g030320.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 252aa MW: 28224.3 Da PI: 7.2454 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 164.3 | 4.5e-51 | 9 | 137 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 lp+GfrF+Ptdeelv++yL+ k++g++ ++ +vi+e+di+k+ePwdLp + vk++++ew fF++ d+ky++g+r nrat +gyWkatgkd++++ Csa13g030320.1 9 LPVGFRFSPTDEELVKYYLRLKINGHDDDV-RVIREIDICKWEPWDLPdfSVVKTTDSEWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKIK 102 79*************************999.99***************6447888999************************************* PP NAM 94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128 s k++ +g+k+tLvfy+grapkg++t W+mheyr+ Csa13g030320.1 103 SGKTKIIGVKRTLVFYTGRAPKGTRTCWIMHEYRA 137 *9999****************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.62E-57 | 5 | 160 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 54.615 | 9 | 160 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.5E-25 | 10 | 136 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 252 aa Download sequence Send to blast |
MDVLSLASLP VGFRFSPTDE ELVKYYLRLK INGHDDDVRV IREIDICKWE PWDLPDFSVV 60 KTTDSEWLFF CPLDRKYPSG SRMNRATVAG YWKATGKDRK IKSGKTKIIG VKRTLVFYTG 120 RAPKGTRTCW IMHEYRATEK DLDGTKSGQN PFVICKLFKK QDIVNGAAPE DSKSCEVEPA 180 VSSPTVVDEM KSEVEMSEVS LVCLKTEDTK PSCDVTESSL LVSSECRSEN SAAEATTTGV 240 RMNKLHVFSL Q* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-49 | 2 | 161 | 10 | 166 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-49 | 2 | 161 | 10 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-49 | 2 | 161 | 10 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-49 | 2 | 161 | 10 | 166 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-49 | 2 | 161 | 13 | 169 | NAC domain-containing protein 19 |
3swm_B | 1e-49 | 2 | 161 | 13 | 169 | NAC domain-containing protein 19 |
3swm_C | 1e-49 | 2 | 161 | 13 | 169 | NAC domain-containing protein 19 |
3swm_D | 1e-49 | 2 | 161 | 13 | 169 | NAC domain-containing protein 19 |
3swp_A | 1e-49 | 2 | 161 | 13 | 169 | NAC domain-containing protein 19 |
3swp_B | 1e-49 | 2 | 161 | 13 | 169 | NAC domain-containing protein 19 |
3swp_C | 1e-49 | 2 | 161 | 13 | 169 | NAC domain-containing protein 19 |
3swp_D | 1e-49 | 2 | 161 | 13 | 169 | NAC domain-containing protein 19 |
4dul_A | 1e-49 | 2 | 161 | 10 | 166 | NAC domain-containing protein 19 |
4dul_B | 1e-49 | 2 | 161 | 10 | 166 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator essential for the anti-viral defense called virus basal resistance response pathway (PubMed:11041886, PubMed:15629774, PubMed:18785827, PubMed:24418554). Not involved in HRT-mediated hypersensitive response (HR) and resistance to TCV (PubMed:18785827). Binds DNA non specifically (PubMed:15629774). Activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). {ECO:0000250|UniProtKB:Q9SCK6, ECO:0000269|PubMed:11041886, ECO:0000269|PubMed:15629774, ECO:0000269|PubMed:18785827, ECO:0000269|PubMed:24418554}.; FUNCTION: (Microbial infection) Compromised function in defense response pathway when interacting with the invading viral capsid protein (CP) of turnip crinkle virus (TCV) due to abnormal subcellular localization. {ECO:0000269|PubMed:11041886, ECO:0000269|PubMed:15629774}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa13g030320.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by bacterial pathogens type III effector proteins (TTEs). {ECO:0000269|PubMed:16553893}.; INDUCTION: (Microbial infection) Accumulates 2 days post infection with turnip crinkle virus (TCV) (PubMed:24418554). {ECO:0000269|PubMed:24418554}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010456676.1 | 1e-175 | PREDICTED: NAC domain-containing protein 91-like | ||||
Swissprot | Q9LKG8 | 1e-153 | NAC91_ARATH; NAC domain-containing protein 91 | ||||
TrEMBL | R0GUL8 | 1e-164 | R0GUL8_9BRAS; Uncharacterized protein | ||||
TrEMBL | R0H6V5 | 1e-164 | R0H6V5_9BRAS; Uncharacterized protein | ||||
STRING | XP_010456676.1 | 1e-174 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2416 | 28 | 73 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G24590.2 | 1e-135 | TCV-interacting protein |
Publications ? help Back to Top | |||
---|---|---|---|
|