PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa10g017570.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | bHLH | ||||||||
Protein Properties | Length: 125aa MW: 14432.6 Da PI: 11.0643 | ||||||||
Description | bHLH family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HLH | 43.9 | 4.4e-14 | 25 | 76 | 2 | 55 |
HHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS HLH 2 rrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 + h+e+E++RR ++ s ++ Lr+llP + ++K s ++ + Av+YIk+Lq Csa10g017570.1 25 KIVHKEIEKQRRLEMASLYASLRSLLPLEF--IQGKRSTSDQVNGAVNYIKYLQ 76 678*************************65..*********************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47459 | 7.98E-14 | 22 | 89 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
CDD | cd00083 | 7.29E-8 | 23 | 80 | No hit | No description |
PROSITE profile | PS50888 | 12.874 | 23 | 75 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Pfam | PF00010 | 2.9E-11 | 25 | 76 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene3D | G3DSA:4.10.280.10 | 3.8E-11 | 25 | 89 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
SMART | SM00353 | 2.9E-5 | 29 | 81 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 125 aa Download sequence Send to blast |
MNDLPEKRRR PSKKLRVSSD QNMKKIVHKE IEKQRRLEMA SLYASLRSLL PLEFIQGKRS 60 TSDQVNGAVN YIKYLQRNVK DMSSKRDDLM LLSGRSFGSC NEQGWNVISK CRDSSVFGRP 120 RNRV* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa10g017570.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010448440.1 | 2e-62 | PREDICTED: transcription factor bHLH118 | ||||
Swissprot | Q9STJ7 | 9e-46 | BH118_ARATH; Transcription factor bHLH118 | ||||
TrEMBL | A0A1P8B7L4 | 3e-49 | A0A1P8B7L4_ARATH; Basic helix-loop-helix (BHLH) DNA-binding superfamily protein | ||||
STRING | XP_010448440.1 | 6e-62 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4479 | 27 | 54 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G25400.1 | 4e-48 | bHLH family protein |