PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa06g051580.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 228aa MW: 25524.1 Da PI: 7.2895 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 275.5 | 6.2e-85 | 17 | 188 | 2 | 170 |
YABBY 2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkee.......lleelkveeenlksnveke 89 d+ s s+++CyvqCnfC+tilavsvP+tslfk+vtvrCG+Ct+llsvn++ +l+a+++l+ +l ++ ++eel+++ +n++++++++ Csa06g051580.1 17 DHLSPSDHLCYVQCNFCDTILAVSVPYTSLFKTVTVRCGCCTTLLSVNMR---LVLPASNQLQLQLGPHsyfnsqnIMEELRDAPSNMNMMMMNQ 108 78899*****************************************8876...57999**********999***99******************* PP YABBY 90 esastsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 +s++++++s+ ++ ++++e+p++ppv+rPPekrqrvPsaynrfikeeiqrika+nPdishreafsaaaknWahfP+ihfgl Csa06g051580.1 109 HSNMNDIPSF-MDLHQQHEIPKAPPVNRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL 188 *********6.5*******************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 1.2E-70 | 21 | 188 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 7.33E-8 | 134 | 181 | IPR009071 | High mobility group box domain |
Gene3D | G3DSA:1.10.30.10 | 8.3E-5 | 136 | 182 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 228 aa Download sequence Send to blast |
MSMSSMSSPS SAVFSPDHLS PSDHLCYVQC NFCDTILAVS VPYTSLFKTV TVRCGCCTTL 60 LSVNMRLVLP ASNQLQLQLG PHSYFNSQNI MEELRDAPSN MNMMMMNQHS NMNDIPSFMD 120 LHQQHEIPKA PPVNRPPEKR QRVPSAYNRF IKEEIQRIKA GNPDISHREA FSAAAKNWAH 180 FPHIHFGLVP DNQPVKKTNM PQQEGEDNMV MKDGFYAPAA NVGVTPY* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the abaxial cell fate determination during embryogenesis and organogenesis. Regulates the initiation of embryonic shoot apical meristem (SAM) development (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6, PubMed:19837869). Required during flower formation and development, particularly for the patterning of floral organs. Positive regulator of class B (AP3 and PI) activity in whorls 2 and 3. Negative regulator of class B activity in whorl 1 and of SUP activity in whorl 3. Interacts with class A proteins (AP1, AP2 and LUG) to repress class C (AG) activity in whorls 1 and 2. Contributes to the repression of KNOX genes (STM, KNAT1/BP and KNAT2) to avoid ectopic meristems. Binds DNA without sequence specificity. In vitro, can compete and displace the AP1 protein binding to DNA containing CArG box (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6). {ECO:0000269|PubMed:10323860, ECO:0000269|PubMed:10331982, ECO:0000269|PubMed:10457020, ECO:0000269|PubMed:11812777, ECO:0000269|PubMed:12417699, ECO:0000269|PubMed:19837869, ECO:0000269|PubMed:9878633, ECO:0000269|Ref.3, ECO:0000269|Ref.6}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa06g051580.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF074948 | 0.0 | AF074948.1 Arabidopsis thaliana FIL mRNA, complete cds. | |||
GenBank | AF087015 | 0.0 | AF087015.1 Arabidopsis thaliana abnormal floral organs protein (AFO) mRNA, complete cds. | |||
GenBank | AF136538 | 0.0 | AF136538.1 Arabidopsis thaliana YABBY1 (YABBY1) mRNA, complete cds. | |||
GenBank | BT026409 | 0.0 | BT026409.1 Arabidopsis thaliana At2g45190 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010506457.1 | 1e-171 | PREDICTED: axial regulator YABBY 1 | ||||
Refseq | XP_010518132.1 | 1e-171 | PREDICTED: axial regulator YABBY 1 | ||||
Swissprot | O22152 | 1e-144 | YAB1_ARATH; Axial regulator YABBY 1 | ||||
TrEMBL | R0HUU7 | 1e-151 | R0HUU7_9BRAS; Uncharacterized protein | ||||
STRING | XP_010506457.1 | 1e-170 | (Camelina sativa) | ||||
STRING | XP_010518132.1 | 1e-170 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2217 | 28 | 77 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45190.1 | 1e-140 | YABBY family protein |