PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa06g048980.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 250aa MW: 28457.1 Da PI: 9.6725 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 97.6 | 5.1e-31 | 25 | 74 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva++ifs++g+lyey+ Csa06g048980.1 25 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSTRGRLYEYA 74 79***********************************************8 PP | |||||||
2 | K-box | 106.6 | 2.8e-35 | 96 | 191 | 7 | 100 |
K-box 7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqk..kekelqeenkaLrkkle 99 s++ea+++++qqe++kL+++i+ +q+ +Rh+lGe+L+sL++keL++Le++Lek+++++RskK+e+l+++ie++qk ke elq++n++Lr+k+ Csa06g048980.1 96 PSVTEANTQYYQQEASKLRRQIRDIQNLNRHILGESLGSLNFKELKNLESRLEKGISRVRSKKHEMLVAEIEYMQKrvKEIELQNDNMYLRSKIT 190 45899**********************************************************************94457789999******997 PP K-box 100 e 100 e Csa06g048980.1 191 E 191 5 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 33.389 | 17 | 77 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 9.1E-40 | 17 | 76 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.96E-32 | 18 | 89 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.50E-43 | 18 | 91 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 19 | 73 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-32 | 19 | 39 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.3E-26 | 26 | 73 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-32 | 39 | 54 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-32 | 54 | 75 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.2E-24 | 101 | 189 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.927 | 103 | 195 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 250 aa Download sequence Send to blast |
MEGGASSNDV AESSKKIGRG KIEIKRIENT TNRQVTFCKR RNGLLKKAYE LSVLCDAEVA 60 LVIFSTRGRL YEYANNSVRG TIERYKKACS DAVNPPSVTE ANTQYYQQEA SKLRRQIRDI 120 QNLNRHILGE SLGSLNFKEL KNLESRLEKG ISRVRSKKHE MLVAEIEYMQ KRVKEIELQN 180 DNMYLRSKIT ERAGLQQQES GAIHQGTVYE SGVTSSHHSE QYNRNYIPVN LLEPNQNSSN 240 HDQPPLQLV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 4e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 4e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 4e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 4e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
5f28_A | 5e-20 | 17 | 85 | 1 | 69 | MEF2C |
5f28_B | 5e-20 | 17 | 85 | 1 | 69 | MEF2C |
5f28_C | 5e-20 | 17 | 85 | 1 | 69 | MEF2C |
5f28_D | 5e-20 | 17 | 85 | 1 | 69 | MEF2C |
6c9l_A | 4e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 4e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 4e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 4e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 4e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 4e-20 | 17 | 85 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Interacts genetically with TT16/AGL32 in a partially antagonistic manner during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). {ECO:0000269|PubMed:27776173}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa06g048980.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT029453 | 0.0 | BT029453.1 Arabidopsis thaliana At2g42830 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010506124.1 | 0.0 | PREDICTED: agamous-like MADS-box protein AGL5 isoform X1 | ||||
Refseq | XP_010508520.1 | 0.0 | PREDICTED: agamous-like MADS-box protein AGL5 isoform X1 | ||||
Refseq | XP_010517826.1 | 0.0 | PREDICTED: agamous-like MADS-box protein AGL5 isoform X1 | ||||
Swissprot | P29385 | 1e-171 | AGL5_ARATH; Agamous-like MADS-box protein AGL5 | ||||
TrEMBL | D7LJD3 | 1e-174 | D7LJD3_ARALL; Uncharacterized protein | ||||
STRING | XP_010506124.1 | 0.0 | (Camelina sativa) | ||||
STRING | XP_010508520.1 | 0.0 | (Camelina sativa) | ||||
STRING | XP_010517826.1 | 0.0 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3341 | 23 | 50 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G42830.2 | 1e-164 | MIKC_MADS family protein |