PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa05g086200.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 274aa MW: 31734.8 Da PI: 6.5892 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 174.5 | 3e-54 | 9 | 134 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 lppGfrFhPtdeel+v+yL++++ +k++++ ++i+evdiyk++Pw+Lp+k++ +e+ewyfFs+r++ky++g r+nra+ sgyWkatg+dk+++s Csa05g086200.1 9 LPPGFRFHPTDEELIVYYLRNQTMSKPCPV-SIIPEVDIYKFDPWQLPEKTEFGENEWYFFSPRERKYPNGVRPNRAAVSGYWKATGTDKAIHS- 101 79****************************.89***************99999*****************************************. PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 ++++vg+kk Lvfykgr pkg ktdW+mheyrl Csa05g086200.1 102 GSSNVGVKKALVFYKGRPPKGIKTDWIMHEYRL 134 999****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.75E-65 | 6 | 161 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 60.611 | 9 | 161 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.0E-26 | 10 | 134 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 274 aa Download sequence Send to blast |
MEVNSSSSLP PGFRFHPTDE ELIVYYLRNQ TMSKPCPVSI IPEVDIYKFD PWQLPEKTEF 60 GENEWYFFSP RERKYPNGVR PNRAAVSGYW KATGTDKAIH SGSSNVGVKK ALVFYKGRPP 120 KGIKTDWIMH EYRLHDSRKA STKRSGSMRL DEWVLCRIYK KRGGAGRLLD EKESFVDEVL 180 NDEATVVVDE ELERRNEEEI TMMTSTTKLP RTCSLAHLLE MDYMGPISHI LTDNFSQLDH 240 HLHQPDSESG WFGDLQFNQD EILNHHRQAM FKF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 4e-70 | 8 | 165 | 16 | 169 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 4e-70 | 8 | 165 | 16 | 169 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 4e-70 | 8 | 165 | 16 | 169 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 4e-70 | 8 | 165 | 16 | 169 | NO APICAL MERISTEM PROTEIN |
3swm_A | 3e-70 | 8 | 165 | 19 | 172 | NAC domain-containing protein 19 |
3swm_B | 3e-70 | 8 | 165 | 19 | 172 | NAC domain-containing protein 19 |
3swm_C | 3e-70 | 8 | 165 | 19 | 172 | NAC domain-containing protein 19 |
3swm_D | 3e-70 | 8 | 165 | 19 | 172 | NAC domain-containing protein 19 |
3swp_A | 3e-70 | 8 | 165 | 19 | 172 | NAC domain-containing protein 19 |
3swp_B | 3e-70 | 8 | 165 | 19 | 172 | NAC domain-containing protein 19 |
3swp_C | 3e-70 | 8 | 165 | 19 | 172 | NAC domain-containing protein 19 |
3swp_D | 3e-70 | 8 | 165 | 19 | 172 | NAC domain-containing protein 19 |
4dul_A | 4e-70 | 8 | 165 | 16 | 169 | NAC domain-containing protein 19 |
4dul_B | 4e-70 | 8 | 165 | 16 | 169 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to, and transactivates the promoter of the abscisic aldehyde oxidase AAO3. Promotes chlorophyll degradation in leaves by enhancing transcription of AAO3, which leads to increased levels of the senescence-inducing hormone abscisic acid (ABA) (PubMed:25516602). Involved in the control of dehydration in senescing leaves. Binds to the DNA sequence 5'-CACGTAAGT-3' of SAG113 promoter. SAG113 acts as negative regulator of ABA signaling for stomatal closure in leaves, and controls water loss during leaf senescence (PubMed:22184656). Transcription factor of the NAC family involved in senescence. May function in the transition between active cell division and cell expansion (PubMed:16640597). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:16640597, ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:22184656, ECO:0000269|PubMed:25516602}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa05g086200.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by the heterodimer APETALA3 (AP3)/PISTILLATA (PI) (PubMed:9489703). Induced by senescence (PubMed:22184656, PubMed:24659488, PubMed:25516602). Induced by abscisic acid (ABA) (PubMed:22184656, PubMed:25516602). Induced by ethylene (PubMed:25516602). {ECO:0000269|PubMed:22184656, ECO:0000269|PubMed:24659488, ECO:0000269|PubMed:25516602, ECO:0000269|PubMed:9489703}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY086124 | 0.0 | AY086124.1 Arabidopsis thaliana clone 21634 mRNA, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010511986.1 | 0.0 | PREDICTED: NAC transcription factor 29-like | ||||
Swissprot | O49255 | 0.0 | NAC29_ARATH; NAC transcription factor 29 | ||||
TrEMBL | A0A178W8K0 | 1e-179 | A0A178W8K0_ARATH; NAP | ||||
TrEMBL | D7KX20 | 1e-178 | D7KX20_ARALL; NAC domain protein NAC2 | ||||
STRING | XP_010511986.1 | 0.0 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM7707 | 26 | 41 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69490.1 | 1e-177 | NAC-like, activated by AP3/PI |