PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa04g063330.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 130aa MW: 14705.8 Da PI: 5.4516 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 49.7 | 1.1e-15 | 2 | 56 | 46 | 100 |
DUF260 46 lkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100 l +lp ++r da+ +l+yeA ar+rdPvyG+vg++++lq+q+++l+aela+++++ Csa04g063330.1 2 LLRLPLHKRFDAVVTLCYEAMARLRDPVYGSVGHLFSLQHQVMNLQAELAHVQAR 56 667899********************************************99976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 10.401 | 1 | 57 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 8.1E-14 | 1 | 54 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 130 aa Download sequence Send to blast |
MLLRLPLHKR FDAVVTLCYE AMARLRDPVY GSVGHLFSLQ HQVMNLQAEL AHVQARLSTF 60 QHFPLQSPQL PPIDLAHNNE YPMEQPSNLD SAWEEEHLLQ GGIEDGEFQE LAMQYISRYL 120 PAVKLPAGT* |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00313 | DAP | Transfer from AT2G45410 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa04g063330.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB473856 | 1e-108 | AB473856.1 Arabidopsis thaliana ASL23 mRNA for ASYMMETRIC LEAVES2-like 23 protein, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010506483.1 | 2e-91 | PREDICTED: LOB domain-containing protein 19 | ||||
Swissprot | O22132 | 7e-72 | LBD19_ARATH; LOB domain-containing protein 19 | ||||
TrEMBL | R0HYN6 | 8e-72 | R0HYN6_9BRAS; Uncharacterized protein | ||||
STRING | XP_010506483.1 | 7e-91 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM108 | 28 | 359 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45410.1 | 3e-74 | LOB domain-containing protein 19 |