PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_012571563.1

Organism

Cicer arietinum

Taxonomic ID

3827

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer

Family

MIKC_MADS

Protein Properties

Length: 238aa MW: 27421.8 Da PI: 9.74

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_012571563.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	88.5	3.6e-28	11	61	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i++k+ rqvtfskRr+g++KKAeELSvLCdaev +i+fsstgkl++y+s XP_012571563.1 11 KKIDDKTARQVTFSKRRKGLFKKAEELSVLCDAEVGLIVFSSTGKLFDYCS 61 68***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.7E-38	3	62	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	29.38	3	63	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.5E-26	5	25	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	5	59	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	5.89E-31	5	74	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	3.6E-26	12	59	IPR002100	Transcription factor, MADS-box
CDD	cd00265	7.05E-31	18	71	No hit	No description
PRINTS	PR00404	2.5E-26	25	40	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.5E-26	40	61	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS51297	10.931	88	182	IPR002487	Transcription factor, K-box
Pfam	PF01486	4.4E-13	93	172	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 238 aa Download sequence Send to blast
MKMKRKKITI KKIDDKTARQ VTFSKRRKGL FKKAEELSVL CDAEVGLIVF SSTGKLFDYC 60 STSMKDTITR YNAQDHGINK LNTPSQELQL EASNRIKLDK EIADRTQQLK QMKGDDIEAL 120 NLNELQLLEK TLHIGFNRVI ETKEKRIMSE ISDLQKMETV LKEENKLLKH KVRNKVEVRQ 180 MISMMSKTRC PSLIDSKIGI QEERVSLDSI SCASDPLFED DYSDTSLKLG LPFSNRRC

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	6e-20	3	71	1	69	MEF2C
5f28_B	6e-20	3	71	1	69	MEF2C
5f28_C	6e-20	3	71	1	69	MEF2C
5f28_D	6e-20	3	71	1	69	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269\|PubMed:16679456, ECO:0000269\|PubMed:18694458, ECO:0000269\|PubMed:19656343, ECO:0000269\|PubMed:25132385}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_012571563.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269\|PubMed:15659097, ECO:0000269\|PubMed:17428825, ECO:0000269\|PubMed:18694458}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012571562.1	1e-173	MADS-box protein SVP-like isoform X1
Refseq	XP_012571563.1	1e-173	MADS-box protein SVP-like isoform X2
Refseq	XP_027190122.1	1e-173	MADS-box protein SVP-like isoform X2
Swissprot	Q9FVC1	3e-70	SVP_ARATH; MADS-box protein SVP
TrEMBL	A0A1S3E6X6	1e-172	A0A1S3E6X6_CICAR; MADS-box protein SVP-like isoform X1
TrEMBL	A0A1S3E829	1e-172	A0A1S3E829_CICAR; MADS-box protein SVP-like isoform X2
STRING	XP_004501636.1	1e-146	(Cicer arietinum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G22540.1	1e-59	MIKC_MADS family protein

Publications ? help Back to Top
Ramamoorthy R,Phua EE,Lim SH,Tan HT,Kumar PP Identification and characterization of RcMADS1, an AGL24 ortholog from the holoparasitic plant Rafflesia cantleyi Solms-Laubach (Rafflesiaceae). PLoS ONE, 2013. 8(6): p. e67243 [PMID:23840638] Jaudal M, et al. Overexpression of Medicago SVP genes causes floral defects and delayed flowering in Arabidopsis but only affects floral development in Medicago. J. Exp. Bot., 2014. 65(2): p. 429-42 [PMID:24249713] Müller-Xing R,Clarenz O,Pokorny L,Goodrich J,Schubert D Polycomb-Group Proteins and FLOWERING LOCUS T Maintain Commitment to Flowering in Arabidopsis thaliana. Plant Cell, 2014. 26(6): p. 2457-2471 [PMID:24920331] Hwan Lee J,Sook Chung K,Kim SK,Ahn JH Post-translational regulation of SHORT VEGETATIVE PHASE as a major mechanism for thermoregulation of flowering. Plant Signal Behav, 2014. 9(4): p. e28193 [PMID:25764420] Chen Z, et al. Overexpression of AtAP1M3 regulates flowering time and floral development in Arabidopsis and effects key flowering-related genes in poplar. Transgenic Res., 2015. 24(4): p. 705-15 [PMID:25820621] Wells CE,Vendramin E,Jimenez Tarodo S,Verde I,Bielenberg DG A genome-wide analysis of MADS-box genes in peach [Prunus persica (L.) Batsch]. BMC Plant Biol., 2015. 15: p. 41 [PMID:25848674] Müller-Xing R,Schubert D,Goodrich J Non-inductive conditions expose the cryptic bract of flower phytomeres in Arabidopsis thaliana. Plant Signal Behav, 2015. 10(4): p. e1010868 [PMID:25924005] Marín-González E, et al. SHORT VEGETATIVE PHASE Up-Regulates TEMPRANILLO2 Floral Repressor at Low Ambient Temperatures. Plant Physiol., 2015. 169(2): p. 1214-24 [PMID:26243615] Bechtold U, et al. Time-Series Transcriptomics Reveals That AGAMOUS-LIKE22 Affects Primary Metabolism and Developmental Processes in Drought-Stressed Arabidopsis. Plant Cell, 2016. 28(2): p. 345-66 [PMID:26842464] Fernández V,Takahashi Y,Le Gourrierec J,Coupland G Photoperiodic and thermosensory pathways interact through CONSTANS to promote flowering at high temperature under short days. Plant J., 2016. 86(5): p. 426-40 [PMID:27117775] Wilson DC,Kempthorne CJ,Carella P,Liscombe DK,Cameron RK Age-Related Resistance in Arabidopsis thaliana Involves the MADS-Domain Transcription Factor SHORT VEGETATIVE PHASE and Direct Action of Salicylic Acid on Pseudomonas syringae. Mol. Plant Microbe Interact., 2017. 30(11): p. 919-929 [PMID:28812948] Zou YP, et al. Adaptation of Arabidopsis thaliana to the Yangtze River basin. Genome Biol., 2017. 18(1): p. 239 [PMID:29284515] Richter R, et al. Floral regulators FLC and SOC1 directly regulate expression of the B3-type transcription factor TARGET OF FLC AND SVP 1 at the Arabidopsis shoot apex via antagonistic chromatin modifications. PLoS Genet., 2019. 15(4): p. e1008065 [PMID:30946745]