PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012570380.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family Dof
Protein Properties Length: 286aa    MW: 32293.4 Da    PI: 4.8357
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012570380.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof116.41.1e-361367660
          zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                     +cprC s+ntkfCyynnysl+qPryfCk+CrryWtkGG+lrnvPvGgg+rkn++
  XP_012570380.1 13 PNCPRCGSSNTKFCYYNNYSLTQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNRR 67
                    58***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-211058IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.6771367IPR003851Zinc finger, Dof-type
PfamPF027012.1E-311367IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101551IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MESTSWKSNE ISPNCPRCGS SNTKFCYYNN YSLTQPRYFC KGCRRYWTKG GSLRNVPVGG  60
GCRKNRRGNN NNKILRQSFD SLTFKNSPNC DTSSDNNNNI SIGHCYDPMM RNITNVSSSS  120
SSPNIDLALV YANFLNQKPN CENSNQIQTT SFDSPSLENS MLSPSKIVTH FSESNNNHEM  180
YCSEFNSMQS FQKDDRIDHQ QQCSNIHDDD GGVNFELPPL PGEEESSAHD DVLWSNSDEI  240
MMNLPFQVTQ QPTPLLGPEI DHDADLLNIG NWCPFDFPND ASFSRP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00405DAPTransfer from AT3G52440Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_012570380.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012570380.20.0dof zinc finger protein DOF3.5
TrEMBLA0A1S3E3P50.0A0A1S3E3P5_CICAR; dof zinc finger protein DOF3.5
STRINGXP_004497698.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18173394
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.18e-34Dof family protein