PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_004508935.1

Organism

Cicer arietinum

Taxonomic ID

3827

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer

Family

MYB

Protein Properties

Length: 199aa MW: 22861.7 Da PI: 7.9608

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_004508935.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	60.8	2.9e-19	15	62	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+ Ed++l+++++ +G + Wkt+a + g++R++k+c++rw++yl XP_004508935.1 15 RGAWTPVEDQKLAQCIQTHGAKKWKTVADKSGLNRCGKSCRLRWLNYL 62 89********************************************97 PP
2	Myb_DNA-binding	53.6	5.1e-17	68	113	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + eE++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l XP_004508935.1 68 RGNISDEEEDLIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 113 7899****************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	16.615	10	62	IPR017930	Myb domain
SuperFamily	SSF46689	2.97E-29	13	109	IPR009057	Homeodomain-like
SMART	SM00717	4.1E-15	14	64	IPR001005	SANT/Myb domain
Pfam	PF00249	2.2E-17	15	62	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.4E-24	16	69	IPR009057	Homeodomain-like
CDD	cd00167	1.33E-10	17	62	No hit	No description
PROSITE profile	PS51294	25.146	63	117	IPR017930	Myb domain
SMART	SM00717	2.1E-14	67	115	IPR001005	SANT/Myb domain
Pfam	PF00249	2.8E-15	68	113	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.8E-25	70	116	IPR009057	Homeodomain-like
CDD	cd00167	1.49E-11	72	113	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009957	Biological Process	epidermal cell fate specification
GO:0010090	Biological Process	trichome morphogenesis
GO:0045892	Biological Process	negative regulation of transcription, DNA-templated
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0048481	Biological Process	plant ovule development
GO:0048629	Biological Process	trichome patterning
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 199 aa Download sequence Send to blast
MAPRKDGSTK KPMNRGAWTP VEDQKLAQCI QTHGAKKWKT VADKSGLNRC GKSCRLRWLN 60 YLRPNIKRGN ISDEEEDLII RLHKLLGNRW SLIAGRLPGR TDNEIKNYWN SHLCKKASHI 120 EEKPETSTTQ ETIAQNNIVE DIVMLESKDS ISGSVNSDVS FDVNEFLDFS TEGSYGFDWV 180 NRYLEFDPIQ FPENTKRSE

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	6e-28	13	117	25	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_004508935.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB490776	1e-101	AB490776.1 Lotus japonicus LjPAP mRNA for R2R3-MYB transcription factor LjPAP, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004508935.1	1e-148	transcription factor MYB114-like
Swissprot	P10290	2e-51	MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBL	A0A1S2YRV5	1e-147	A0A1S2YRV5_CICAR; transcription factor MYB114-like
STRING	XP_004508935.1	1e-148	(Cicer arietinum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF2148	32	88

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G35550.1	1e-52	MYB family protein

Publications ? help Back to Top
Chen B,Wang X,Hu Y,Wang Y,Lin Z Ectopic expression of a c1-I allele from maize inhibits pigment formation in the flower of transgenic tobacco. Mol. Biotechnol., 2004. 26(3): p. 187-92 [PMID:15004287] Paz-Ares J,Ghosal D,Saedler H Molecular analysis of the C1-I allele from Zea mays: a dominant mutant of the regulatory C1 locus. EMBO J., 1990. 9(2): p. 315-21 [PMID:2303027] Cone KC,Burr FA,Burr B Molecular analysis of the maize anthocyanin regulatory locus C1. Proc. Natl. Acad. Sci. U.S.A., 1986. 83(24): p. 9631-5 [PMID:3025847] Paz-Ares J,Ghosal D,Wienand U,Peterson PA,Saedler H The regulatory c1 locus of Zea mays encodes a protein with homology to myb proto-oncogene products and with structural similarities to transcriptional activators. EMBO J., 1987. 6(12): p. 3553-8 [PMID:3428265] Scheffler B, et al. Molecular analysis of C1 alleles in Zea mays defines regions involved in the expression of this regulatory gene. Mol. Gen. Genet., 1994. 242(1): p. 40-8 [PMID:7904044] Franken P,Schrell S,Peterson PA,Saedler H,Wienand U Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38. Plant J., 1994. 6(1): p. 21-30 [PMID:7920701] Singer T,Gierl A,Peterson PA Three new dominant C1 suppressor alleles in Zea mays. Genet. Res., 1998. 71(2): p. 127-32 [PMID:9717435]