PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004502598.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family Dof
Protein Properties Length: 330aa    MW: 36790.1 Da    PI: 4.6162
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004502598.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.93.8e-3750104660
          zf-Dof   6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                      +cprC stntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rk ++
  XP_004502598.1  50 PNCPRCASTNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKTRR 104
                     58**************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-253995IPR003851Zinc finger, Dof-type
PfamPF027018.8E-3250104IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.56550104IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105288IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MFPQRHNNIS SIELEQMLHL LSSSSSSPIP LSTSMDKSNS RWKPNIEIAP NCPRCASTNT  60
KFCYYNNYSL SQPRYFCKGC RRYWTKGGSL RNVPVGGGCR KTRRGKTIRN SHTDRLSANG  120
SEDDADGHHH QSQNNGSRDI DMALVFAKFL NQNPTNSDHG EEFENENEPI NNGSPSSNNI  180
NNLSTPESVE TENDAVVHPQ NPFDADSVAL NGELSLSGID EFEGFLGVDE DVVQDVLWSH  240
SDANANVNAM MMVSSSNYTW QQPSSMMQMD ELEYSMPLPI LNENGTHDDQ LLSHTFNSNS  300
TTVNLINDSW NSWGSFDLST MEVFSSSSRP
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004502598.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004502598.10.0dof zinc finger protein DOF5.1
TrEMBLA0A1S2YC210.0A0A1S2YC21_CICAR; dof zinc finger protein DOF5.1
STRINGXP_004502598.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18173394
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.12e-35Dof family protein