PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_004498959.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 145aa MW: 16897.3 Da PI: 9.6546 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 32.2 | 2.3e-10 | 60 | 109 | 5 | 54 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 ++ rr+q+NRe+ArrsR RKk +e+L+ L eN++Lk++l + XP_004498959.1 60 RKLRRMQSNRESARRSRWRKKRHVENLTSDLNRLRLENRELKNRLGLTMN 109 5789**************************************99876554 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 4.4E-12 | 56 | 120 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 9.99 | 58 | 104 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 5.8E-8 | 60 | 111 | No hit | No description |
Pfam | PF00170 | 6.5E-9 | 60 | 105 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 6.11E-11 | 60 | 114 | No hit | No description |
CDD | cd14702 | 1.48E-14 | 61 | 108 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 63 | 78 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 145 aa Download sequence Send to blast |
MSFHEEKIPV RFGCLPVHET MFTQGELEEL FSLINQPVDP TSPGSGSQGS NQAVYSIPER 60 KLRRMQSNRE SARRSRWRKK RHVENLTSDL NRLRLENREL KNRLGLTMNY NLLLSTENQC 120 LKSESMSLIV TLLDLYRTLE TMISQ |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_004498959.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004498959.1 | 1e-103 | basic leucine zipper 4 | ||||
TrEMBL | A0A1S2Y5R4 | 1e-101 | A0A1S2Y5R4_CICAR; basic leucine zipper 4 | ||||
STRING | XP_004498959.1 | 1e-102 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5996 | 30 | 52 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G49760.1 | 5e-11 | basic leucine-zipper 5 |