PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_004488426.1

Organism

Cicer arietinum

Taxonomic ID

3827

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer

Family

MIKC_MADS

Protein Properties

Length: 240aa MW: 27876.8 Da PI: 8.9778

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_004488426.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	99.6	1.3e-31	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+i+fs++gklyeyss XP_004488426.1 9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSNKGKLYEYSS 59 79***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	32.744	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	4.6E-41	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.96E-35	2	93	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.31E-43	2	79	No hit	No description
PRINTS	PR00404	4.2E-32	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	5.4E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.2E-32	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.2E-32	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	5.3E-27	84	172	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	16.451	88	178	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0010077	Biological Process	maintenance of inflorescence meristem identity
GO:0010154	Biological Process	fruit development
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 240 aa Download sequence Send to blast
MGRGRVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVALIVFSN KGKLYEYSSD 60 PCMERILERY ERYSYAERQL VATDQPQNEN WIIEHAKLKA RLEIIQRNQR NFMGEELDGL 120 SIKELQNLEH QLDSALKQIR SRKNQLMYES ISELHKKDKA LQEKNNLLVK KIKEKEKELA 180 QLEQQYDAID LTSTVLASQP LETLNIGGSP QGRGDGEDNE GNQTRVNTLF PPWMLRPVNE

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	9e-22	1	74	1	73	Myocyte-specific enhancer factor 2B
1tqe_Q	9e-22	1	74	1	73	Myocyte-specific enhancer factor 2B
1tqe_R	9e-22	1	74	1	73	Myocyte-specific enhancer factor 2B
1tqe_S	9e-22	1	74	1	73	Myocyte-specific enhancer factor 2B
6byy_A	9e-22	1	84	1	83	MEF2 CHIMERA
6byy_B	9e-22	1	84	1	83	MEF2 CHIMERA
6byy_C	9e-22	1	84	1	83	MEF2 CHIMERA
6byy_D	9e-22	1	84	1	83	MEF2 CHIMERA
6bz1_A	1e-21	1	74	1	73	MEF2 CHIMERA
6bz1_B	1e-21	1	74	1	73	MEF2 CHIMERA
6bz1_C	1e-21	1	74	1	73	MEF2 CHIMERA
6bz1_D	1e-21	1	74	1	73	MEF2 CHIMERA
6c9l_A	9e-22	1	74	1	73	Myocyte-specific enhancer factor 2B
6c9l_B	9e-22	1	74	1	73	Myocyte-specific enhancer factor 2B
6c9l_C	9e-22	1	74	1	73	Myocyte-specific enhancer factor 2B
6c9l_D	9e-22	1	74	1	73	Myocyte-specific enhancer factor 2B
6c9l_E	9e-22	1	74	1	73	Myocyte-specific enhancer factor 2B
6c9l_F	9e-22	1	74	1	73	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that promotes early floral meristem identity in synergy with APETALA1 and CAULIFLOWER. Is required subsequently for the transition of an inflorescence meristem into a floral meristem (PubMed:28586421). Seems to be partially redundant to the function of APETALA1 and CAULIFLOWER in the up-regulation of LEAFY. Is also required for normal pattern of cell division, expansion and differentiation during morphogenesis of the silique (PubMed:28586421). Probably not required for fruit elongation but instead is required to prevent ectopic activity of IND. Represses SAUR10 expression in stems and inflorescence branches (PubMed:28586421). {ECO:0000269\|PubMed:10648231, ECO:0000269\|PubMed:15035986, ECO:0000269\|PubMed:28586421, ECO:0000269\|PubMed:9502732}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_004488426.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Dramatically up-regulated upon the transition from vegetative to reproductive development.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT052704	0.0	BT052704.1 Medicago truncatula clone MTYFD_FE_FF_FG1G-I-18 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004488426.1	1e-177	truncated transcription factor CAULIFLOWER A-like
Swissprot	Q38876	1e-110	AGL8_ARATH; Agamous-like MADS-box protein AGL8
TrEMBL	A0A1S2XH92	1e-175	A0A1S2XH92_CICAR; truncated transcription factor CAULIFLOWER A-like
STRING	XP_004488426.1	1e-176	(Cicer arietinum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF588	32	119

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G60910.1	1e-100	AGAMOUS-like 8

Publications ? help Back to Top
Yu Y, et al. MlWRKY12, a novel Miscanthus transcription factor, participates in pith secondary cell wall formation and promotes flowering. Plant Sci., 2013. 212: p. 1-9 [PMID:24094048] Pabón-Mora N,Wong GK,Ambrose BA Evolution of fruit development genes in flowering plants. Front Plant Sci, 2014. 5: p. 300 [PMID:25018763] Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons. GM Crops Food, 2014. 5(4): p. 302-20 [PMID:25523176] Wang C,Dehesh K From retrograde signaling to flowering time. Plant Signal Behav, 2015. 10(6): p. e1022012 [PMID:26098376] Borghi M,Xie DY Tissue-specific production of limonene in Camelina sativa with the Arabidopsis promoters of genes BANYULS and FRUITFULL. Planta, 2016. 243(2): p. 549-61 [PMID:26530959] Yu Y, et al. WRKY71 accelerates flowering via the direct activation of FLOWERING LOCUS T and LEAFY in Arabidopsis thaliana. Plant J., 2016. 85(1): p. 96-106 [PMID:26643131] McCarthy EW,Mohamed A,Litt A Functional Divergence of APETALA1 and FRUITFULL is due to Changes in both Regulation and Coding Sequence. Front Plant Sci, 2015. 6: p. 1076 [PMID:26697035] Davin N, et al. Functional network analysis of genes differentially expressed during xylogenesis in soc1ful woody Arabidopsis plants. Plant J., 2016. 86(5): p. 376-90 [PMID:26952251] Hyun Y, et al. Multi-layered Regulation of SPL15 and Cooperation with SOC1 Integrate Endogenous Flowering Pathways at the Arabidopsis Shoot Meristem. Dev. Cell, 2016. 37(3): p. 254-66 [PMID:27134142] José Ripoll J, et al. microRNA regulation of fruit growth. Nat Plants, 2015. 1(4): p. 15036 [PMID:27247036] Li W,Wang H,Yu D Arabidopsis WRKY Transcription Factors WRKY12 and WRKY13 Oppositely Regulate Flowering under Short-Day Conditions. Mol Plant, 2016. 9(11): p. 1492-1503 [PMID:27592586] Eldridge T, et al. Fruit shape diversity in the Brassicaceae is generated by varying patterns of anisotropy. Development, 2016. 143(18): p. 3394-406 [PMID:27624834] Bemer M, et al. FRUITFULL controls SAUR10 expression and regulates Arabidopsis growth and architecture. J. Exp. Bot., 2017. 68(13): p. 3391-3403 [PMID:28586421] Sehra B,Franks RG Redundant CArG Box Cis-motif Activity Mediates SHATTERPROOF2 Transcriptional Regulation during Arabidopsis thaliana Gynoecium Development. Front Plant Sci, 2017. 8: p. 1712 [PMID:29085379] Balanzà V, et al. Genetic control of meristem arrest and life span in Arabidopsis by a FRUITFULL-APETALA2 pathway. Nat Commun, 2018. 9(1): p. 565 [PMID:29422669]