PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA11g14610
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 248aa    MW: 28424.5 Da    PI: 6.6197
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA11g14610genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.6e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd +l+ +++++G+ +W+  +++ g+ R++k+c++rw++yl
       CA11g14610 14 KGTWTPEEDRKLAAYITEYGPWNWRQLPKYAGLERCGKSCRLRWLNYL 61
                     799*****************88************************97 PP

2Myb_DNA-binding60.73.1e-1967110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eEde+++++++qlG++ W++Ia++++ gR+++++k++w++
       CA11g14610  67 RGNYTEEEDEIILNLHAQLGNK-WSAIAAHLP-GRSDNEIKNHWHT 110
                      899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.213961IPR017930Myb domain
SuperFamilySSF466893.56E-3011108IPR009057Homeodomain-like
SMARTSM007174.5E-121363IPR001005SANT/Myb domain
PfamPF002492.4E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-231568IPR009057Homeodomain-like
CDDcd001672.97E-91661No hitNo description
PROSITE profilePS5129426.9562116IPR017930Myb domain
SMARTSM007171.7E-1766114IPR001005SANT/Myb domain
PfamPF002493.1E-1767110IPR001005SANT/Myb domain
CDDcd001672.05E-1269110No hitNo description
Gene3DG3DSA:1.10.10.609.7E-2769115IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MVRTPCCDEN GRKKGTWTPE EDRKLAAYIT EYGPWNWRQL PKYAGLERCG KSCRLRWLNY  60
LRPNVKRGNY TEEEDEIILN LHAQLGNKWS AIAAHLPGRS DNEIKNHWHT ALKKRANNSG  120
ESSKKCNSKN NIRRSTTVAN KNASPSTSHE NIVLESSQWS PKESSSEDFF SYSNTDYQEQ  180
HKVFQQEALD EITSGSFWTE PFLVESFNTT GTDFLAPPID YCGLVCPPSP FIGHEFLSSF  240
DFDYFNY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-291411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtFunctions as a repressor of epidermal cell outgrowth and negatively regulate trichome branch formation (PubMed:18805951, PubMed:21070410). Acts as both a positive and negative regulator of cellular outgrowth. Promotes both trichome expansion and branch formation (PubMed:21070410). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). May play a role in the regulation of cuticle formation in vegetative organs (PubMed:24169067). {ECO:0000269|PubMed:18805951, ECO:0000269|PubMed:21070410, ECO:0000269|PubMed:23709630, ECO:0000269|PubMed:24169067}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755199e-43HG975519.1 Solanum lycopersicum chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016579451.10.0PREDICTED: myb-related protein Myb4-like
SwissprotQ9LE631e-57MY106_ARATH; Transcription factor MYB106
TrEMBLA0A2G2XZS30.0A0A2G2XZS3_CAPAN; Transcription factor MYB39
STRINGSolyc07g053230.2.11e-125(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28110.15e-58myb domain protein 41