PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA11g00850
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 299aa    MW: 34750.9 Da    PI: 8.3693
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA11g00850genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.6e-182269148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll++++  +G g+W++ a++ g++Rt+k+c++rw++yl
       CA11g00850 22 RGPWTLEEDNLLIHYISTHGEGRWNALAKCAGLKRTGKSCRLRWLNYL 69
                     89********************************************97 PP

2Myb_DNA-binding52.71e-1675118146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T++E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
       CA11g00850  75 RGNLTPQEQLLILELHSKWGNR-WSKIAQHLP-GRTDNEIKNYWRT 118
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.4181769IPR017930Myb domain
SuperFamilySSF466891.95E-3119116IPR009057Homeodomain-like
SMARTSM007171.6E-162171IPR001005SANT/Myb domain
PfamPF002492.1E-172269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-242376IPR009057Homeodomain-like
CDDcd001672.03E-112469No hitNo description
PROSITE profilePS5129425.75170124IPR017930Myb domain
SMARTSM007172.7E-1574122IPR001005SANT/Myb domain
PfamPF002491.0E-1575118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2377123IPR009057Homeodomain-like
CDDcd001672.12E-1079118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009686Biological Processgibberellin biosynthetic process
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MSSNNNNNNL SSNEDELFEL RRGPWTLEED NLLIHYISTH GEGRWNALAK CAGLKRTGKS  60
CRLRWLNYLK PDIKRGNLTP QEQLLILELH SKWGNRWSKI AQHLPGRTDN EIKNYWRTRV  120
QKQARQLKVD SNSKKFVEAI KNLWVPRLLE KMEQCSSSST IDKKQNINNL SFPNLPLINN  180
QESCTKDNKS SHDDDNTNTN SNSNNNNTTW GSLGSSMNEN FNICNNSMHQ DDECYYVENN  240
FNQQXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXMILIII*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-251912424128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00216DAPTransfer from AT1G68320Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754444e-76HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016546618.11e-177PREDICTED: transcription factor MYB24
TrEMBLA0A2G2YC681e-177A0A2G2YC68_CAPAN; Transcription factor MYB24 (Fragment)
STRINGSolyc05g009230.1.11e-124(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.12e-85myb domain protein 62