PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CA07g12060 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 100aa MW: 11148.4 Da PI: 4.2906 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 30.9 | 6.5e-10 | 50 | 91 | 2 | 45 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 + ++++E+ l+++ +++ G + W++Ia +++ gR++ ++ +w CA07g12060 50 LEFSEDEEILIAKMFNLVGER-WSLIAGRIP-GRSADEIEKYWK 91 579******************.*********.***********6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50090 | 6.864 | 44 | 94 | IPR017877 | Myb-like domain |
SMART | SM00717 | 1.0E-5 | 48 | 96 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.67E-7 | 51 | 91 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.9E-11 | 51 | 91 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.79E-7 | 51 | 91 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 5.2E-9 | 51 | 91 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0080147 | Biological Process | root hair cell development | ||||
GO:1900033 | Biological Process | negative regulation of trichome patterning | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 100 aa Download sequence Send to blast |
MADCDRSSTS DNASVVSAEF EQKLLSSRES TIDPPAVTAL ETTNKETSEL EFSEDEEILI 60 AKMFNLVGER WSLIAGRIPG RSADEIEKYW KLRIYSKSQ* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. {ECO:0000269|PubMed:15063185, ECO:0000269|PubMed:15584952}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975519 | 5e-33 | HG975519.1 Solanum lycopersicum chromosome ch07, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016555412.1 | 5e-67 | PREDICTED: MYB-like transcription factor ETC3 | ||||
Refseq | XP_016579424.1 | 5e-67 | PREDICTED: MYB-like transcription factor ETC3 | ||||
Swissprot | Q9LNI5 | 2e-15 | ETC1_ARATH; MYB-like transcription factor ETC1 | ||||
TrEMBL | A0A1U8F7W0 | 1e-65 | A0A1U8F7W0_CAPAN; MYB-like transcription factor ETC3 | ||||
TrEMBL | A0A2G2WD81 | 1e-65 | A0A2G2WD81_CAPBA; Transcription factor TRY | ||||
TrEMBL | A0A2G3C0E9 | 1e-65 | A0A2G3C0E9_CAPCH; Transcription factor TRY | ||||
STRING | Solyc07g052490.2.1 | 5e-36 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA6579 | 19 | 32 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G01380.1 | 7e-15 | MYB_related family protein |