PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA06g00130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 233aa    MW: 27164.6 Da    PI: 6.5055
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA06g00130genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.19.7e-14957148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.kgRtlkqcksrwqkyl 48
                     +g+W+ +Ed +l++ + +lG g+W++ +r    ++R++k+c++rw++yl
       CA06g00130  9 KGPWSSDEDSKLIHSISLLGQGRWDSLSRFAVgLKRSGKSCRLRWLNYL 57
                     79*********************************************97 PP

2Myb_DNA-binding44.53.7e-1463106146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T++E++l++ ++ ++G++ W++Ia+ ++ gR+++++k++w++
       CA06g00130  63 RGKITPQEQLLIILLHFRFGNR-WSKIAENLP-GRSDNDVKNYWRT 106
                      8999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.848457IPR017930Myb domain
SuperFamilySSF466891.42E-266104IPR009057Homeodomain-like
SMARTSM007172.8E-12859IPR001005SANT/Myb domain
PfamPF002492.5E-12957IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-181064IPR009057Homeodomain-like
CDDcd001674.64E-91157No hitNo description
PROSITE profilePS5129420.06158112IPR017930Myb domain
SMARTSM007172.3E-1362110IPR001005SANT/Myb domain
PfamPF002491.9E-1363106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.1E-2165110IPR009057Homeodomain-like
CDDcd001674.74E-1067106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MEASMEMKKG PWSSDEDSKL IHSISLLGQG RWDSLSRFAV GLKRSGKSCR LRWLNYLRPN  60
LRRGKITPQE QLLIILLHFR FGNRWSKIAE NLPGRSDNDV KNYWRTKVQK HAKELHCDVN  120
NSHQFRHFLL YQWLPSLLAQ QISPTTPPSS PNNMMTCPNA DFISSPEDNN TSYNIWNNLS  180
SFEDEINISH DYSIPTDDEY YCHNYWPTTP SQVLLPDEML CLDDDMDLWL FP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-24611024126MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269|PubMed:22301384}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269|PubMed:22301384}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016555564.11e-170PREDICTED: transcription factor MYB108
SwissprotQ10MB42e-58MYB2_ORYSJ; Transcription factor MYB2
TrEMBLA0A2G2Z6G11e-169A0A2G2Z6G1_CAPAN; Transcription factor
STRINGSolyc06g009480.1.11e-104(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.13e-58myb domain protein 112
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Yang A,Dai X,Zhang WH
    A R2R3-type MYB gene, OsMYB2, is involved in salt, cold, and dehydration tolerance in rice.
    J. Exp. Bot., 2012. 63(7): p. 2541-56
    [PMID:22301384]
  3. Chen X, et al.
    The NAC family transcription factor OsNAP confers abiotic stress response through the ABA pathway.
    Plant Cell Physiol., 2014. 55(3): p. 604-19
    [PMID:24399239]
  4. Lv Y, et al.
    New insights into the genetic basis of natural chilling and cold shock tolerance in rice by genome-wide association analysis.
    Plant Cell Environ., 2016. 39(3): p. 556-70
    [PMID:26381647]
  5. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]