PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CA05g09900 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
||||||||
Family | SAP | ||||||||
Protein Properties | Length: 164aa MW: 18126.7 Da PI: 6.7563 | ||||||||
Description | SAP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SAP | 249.9 | 9.3e-77 | 1 | 163 | 293 | 455 |
SAP 293 mGWhmlteltelvGrvrvteretavaCtslrlvvfdlrnqgvvlreeeerrGlivssldasneayvvvdsrGvatvrrvenleevcrfrvrg.aqrgvl 390 mGWh+ltelte+vGr+rvt retavaCtsl+l+++dlrnqg+++r + +rrGliv+s+da ne++v+vdsrG+a+vrr+++lee+crf+vrg qrgv+ CA05g09900 1 MGWHILTELTEMVGRIRVTTRETAVACTSLQLMAIDLRNQGIIIRAQPSRRGLIVASFDARNETLVAVDSRGMASVRRADDLEEICRFNVRGdNQRGVV 99 8************************************************************************************************** PP SAP 391 gCvnggyalvyaggvlrvWeiekkegylyslrervgevnalvaddrhvavsssdgtihlldfgaq 455 gC+nggyal+++g+v+rvW+ie+ + lyslrer+g+ na++ad+r+va++ssd+tihl+dfgaq CA05g09900 100 GCMNGGYALMWIGSVIRVWDIEHGA-CLYSLRERIGNNNAIIADERYVAACSSDATIHLWDFGAQ 163 ***********************77.9************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.130.10.10 | 7.9E-10 | 21 | 160 | IPR015943 | WD40/YVTN repeat-like-containing domain |
SuperFamily | SSF50998 | 5.1E-11 | 22 | 161 | IPR011047 | Quinoprotein alcohol dehydrogenase-like superfamily |
PROSITE profile | PS50294 | 9.046 | 115 | 163 | IPR017986 | WD40-repeat-containing domain |
PROSITE profile | PS50082 | 8.57 | 142 | 163 | IPR001680 | WD40 repeat |
PROSITE pattern | PS00678 | 0 | 146 | 160 | IPR019775 | WD40 repeat, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005515 | Molecular Function | protein binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 164 aa Download sequence Send to blast |
MGWHILTELT EMVGRIRVTT RETAVACTSL QLMAIDLRNQ GIIIRAQPSR RGLIVASFDA 60 RNETLVAVDS RGMASVRRAD DLEEICRFNV RGDNQRGVVG CMNGGYALMW IGSVIRVWDI 120 EHGACLYSLR ERIGNNNAII ADERYVAACS SDATIHLWDF GAQ* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator involved in the specification of floral identity. Acts as A class cadastral protein by repressing the C class floral homeotic gene AGAMOUS in the external flower organs in association with APETALA2 and other repressors. Is required to maintain floral meristem identity in concert with AGAMOUS. Interacts also with APETALA2 to ensure the normal development of ovule. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016574645.1 | 1e-112 | PREDICTED: transcriptional regulator STERILE APETALA isoform X1 | ||||
Refseq | XP_016574646.1 | 1e-113 | PREDICTED: transcriptional regulator STERILE APETALA isoform X2 | ||||
Swissprot | Q9FKH1 | 6e-54 | SAP_ARATH; Transcriptional regulator STERILE APETALA | ||||
TrEMBL | A0A1U8GTR5 | 1e-111 | A0A1U8GTR5_CAPAN; transcriptional regulator STERILE APETALA isoform X2 | ||||
TrEMBL | A0A1U8GU38 | 1e-111 | A0A1U8GU38_CAPAN; Transcriptional regulator STERILE APETALA | ||||
TrEMBL | A0A2G2ZI71 | 1e-111 | A0A2G2ZI71_CAPAN; transcriptional regulator STERILE APETALA isoform X1 | ||||
TrEMBL | A0A2G3CFU7 | 1e-111 | A0A2G3CFU7_CAPCH; Transcriptional regulator STERILE APETALA | ||||
STRING | XP_009596786.1 | 5e-97 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA21819 | 2 | 2 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G35770.1 | 2e-56 | SAP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|