PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

CA05g09600

Organism

Capsicum annuum

Taxonomic ID

4072

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum

Family

NAC

Protein Properties

Length: 104aa MW: 11728.6 Da PI: 9.8731

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
CA05g09600	genome	PEP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	55.9	1.4e-17	10	56	1	48
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48 lppGfrFhPtdeel+++yL ++++++++++ ++i+e+d+yk++Pw+Lp CA05g09600 10 LPPGFRFHPTDEELIMYYLPNQATSRPCPV-SIIPEFDVYKFDPWQLP 56 79**************************.89************9 PP
2	NAM	34.5	6.2e-11	63	101	73	112
NAM 73 rknratksgyWkatgkdkevlskkgelvglkktLvfykgr 112 r+nra+ sgyWkatg+dk+++s +++ vg+kk Lvf + + CA05g09600 63 RPNRAAVSGYWKATGTDKAIYS-GSTYVGIKKALVFLQRK 101 89******************.999********9654 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	6.28E-34	8	101	IPR003441	NAC domain
PROSITE profile	PS51005	25.898	10	103	IPR003441	NAC domain
Pfam	PF02365	1.2E-14	11	98	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 104 aa Download sequence Send to blast
MVGKNSSEHL PPGFRFHPTD EELIMYYLPN QATSRPCPVS IIPEFDVYKF DPWQLPGLKI 60 WIRPNRAAVS GYWKATGTDK AIYSGSTYVG IKKALVFLQR KVP*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	3e-29	9	103	14	126	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence (developmental, light-induced and ABA-induced senescence) and regulates fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. Activates the expression of senescence and ABA associated genes including NCED1, ABCG40, CYP707A2, SAG113, SGR1 and PAO, by directly binding to their promoters. {ECO:0000269\|PubMed:29760199}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. Induced by abscisic acid (ABA). {ECO:0000269\|PubMed:29760199}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	CU468639	9e-41	CU468639.4 S.lycopersicum DNA sequence from clone SL_MboI-101P13 on chromosome 4, complete sequence.
GenBank	HG975443	9e-41	HG975443.1 Solanum pennellii chromosome ch04, complete genome.
GenBank	HG975516	9e-41	HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009781251.1	1e-53	PREDICTED: NAC transcription factor 29-like
Refseq	XP_016451619.1	1e-53	PREDICTED: NAC transcription factor 29-like
Swissprot	K4BNG7	2e-53	NAP2_SOLLC; NAC domain-containing protein 2
TrEMBL	A0A2G2ZHN5	4e-71	A0A2G2ZHN5_CAPAN; NAC transcription factor NAM-B2
STRING	XP_009781251.1	4e-53	(Nicotiana sylvestris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA746	24	103

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69490.1	2e-47	NAC-like, activated by AP3/PI

Publications ? help Back to Top
Tomato Genome Consortium The tomato genome sequence provides insights into fleshy fruit evolution. Nature, 2012. 485(7400): p. 635-41 [PMID:22660326] Ma X, et al. The NAC Transcription Factor SlNAP2 Regulates Leaf Senescence and Fruit Yield in Tomato. Plant Physiol., 2018. 177(3): p. 1286-1302 [PMID:29760199]