PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA03g02670
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 262aa    MW: 30700.6 Da    PI: 9.2914
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA03g02670genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.71.3e-182370148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed ll+++vk++G g+W+++ar  g++R +k+c++rw +yl
       CA03g02670 23 KGPWTADEDRLLIEYVKLHGEGRWNSVARLTGLRRNGKSCRLRWVNYL 70
                     79********************************************97 PP

2Myb_DNA-binding51.81.9e-1676120147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg  T+ E+++++++++++G++ W+tIar ++ gRt++++k++w+++
       CA03g02670  76 RGQITPNEEKIILELHARWGNR-WSTIARSLP-GRTDNEIKNYWRTH 120
                      7888******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.5511874IPR017930Myb domain
SuperFamilySSF466898.61E-3022117IPR009057Homeodomain-like
SMARTSM007172.5E-162272IPR001005SANT/Myb domain
PfamPF002495.7E-172370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-232477IPR009057Homeodomain-like
CDDcd001671.76E-112570No hitNo description
PROSITE profilePS5129419.13775125IPR017930Myb domain
SMARTSM007178.5E-1475123IPR001005SANT/Myb domain
PfamPF002492.2E-1476120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-2478124IPR009057Homeodomain-like
CDDcd001672.12E-980121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MVCEITSEQM GSNWGFIEEV WRKGPWTADE DRLLIEYVKL HGEGRWNSVA RLTGLRRNGK  60
SCRLRWVNYL RPDLKRGQIT PNEEKIILEL HARWGNRWST IARSLPGRTD NEIKNYWRTH  120
FKKKTKNSCD NSEKSRASLW KRQQFQLQQQ QQQQQIKNQI DIKKVMSLPT MAQAKQEMAI  180
LYPNIYTIDQ QDQVGLFYSM LNNSTSISQS EPSSSNEDIM WDDLWNLDDF YGHFINSTTY  240
NKTNTSPCLQ PMASTTTPSF Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-272312527128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754481e-128HG975448.1 Solanum pennellii chromosome ch09, complete genome.
GenBankHG9755211e-128HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016568105.11e-176PREDICTED: myb-related protein 305-like isoform X1
TrEMBLA0A2G2ZU800.0A0A2G2ZU80_CAPAN; Myb-related protein
STRINGPGSC0003DMT4000037961e-133(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.12e-76myb domain protein 305