PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g29740
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 199aa    MW: 22906.4 Da    PI: 7.2153
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g29740genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.7e-181562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l+++++ +G g W++ ar  g++Rt+k+c++rw++yl
       CA02g29740 15 KGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYL 62
                     79********************************************97 PP

2Myb_DNA-binding35.13.2e-1168107146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE++l+ ++++    + W++Ia++++ gRt++++k++w++
       CA02g29740  68 RGNITPEEQLLIMELHA----K-WSKIAKHLP-GRTDNEIKNYWRT 107
                      78889999999999987....5.99*******.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-23765IPR009057Homeodomain-like
PROSITE profilePS5129421.9211066IPR017930Myb domain
SuperFamilySSF466894.04E-2613105IPR009057Homeodomain-like
SMARTSM007171.0E-121464IPR001005SANT/Myb domain
PfamPF002492.9E-161562IPR001005SANT/Myb domain
CDDcd001675.22E-101762No hitNo description
Gene3DG3DSA:1.10.10.602.2E-2066113IPR009057Homeodomain-like
PROSITE profilePS5129413.95867113IPR017930Myb domain
SMARTSM007171.9E-767111IPR001005SANT/Myb domain
PfamPF002497.7E-1068107IPR001005SANT/Myb domain
CDDcd001671.49E-972107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MDKRTCNSQD VEVRKGPWTM EEDLILINYI ANHGEGVWNS LARSAGLKRT GKSCRLRWLN  60
YLRPDVRRGN ITPEEQLLIM ELHAKWSKIA KHLPGRTDNE IKNYWRTRIQ KHIKQAENMN  120
RLSSDISDQH NNDQQASTSQ ASIGPPDTIE TYSGNNNNNN NIMGTNFHHQ GNFSTETNEN  180
IWSMEELWSM QLLNDATN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-21151137108B-MYB
1h8a_C2e-211211324128MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000305}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC1826281e-123KC182628.1 Petunia x hybrida cultivar P720 EOBI (EOBI) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016561570.11e-138PREDICTED: myb-related protein 340-like
SwissprotP813964e-92MYB40_ANTMA; Myb-related protein 340
TrEMBLA0A2G3ABV71e-145A0A2G3ABV7_CAPAN; Transcription factor MYB21
STRINGPGSC0003DMT4000012781e-114(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.17e-78myb domain protein 21
Publications ? help Back to Top
  1. Jackson D,Culianez-Macia F,Prescott AG,Roberts K,Martin C
    Expression patterns of myb genes from Antirrhinum flowers.
    Plant Cell, 1991. 3(2): p. 115-25
    [PMID:1840903]