PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA01g34630
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 278aa    MW: 32286.2 Da    PI: 10.2611
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA01g34630genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.39.5e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+t Ed+ll +++k+ G g+W+  +++ g+ R++k+c++rw +yl
       CA01g34630 14 KGPWSTKEDLLLTNYIKENGEGQWRNLPNKAGLLRCGKSCRLRWMNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding53.94.1e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++++Ed+l+++++ +lG++ W++I+ +++ gRt++++k++w+++l
       CA01g34630  67 RGNFSQDEDDLIIRLHSLLGNR-WSLISGRLP-GRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-21564IPR009057Homeodomain-like
PROSITE profilePS5129414.956961IPR017930Myb domain
SuperFamilySSF466892.98E-2811108IPR009057Homeodomain-like
SMARTSM007177.3E-111363IPR001005SANT/Myb domain
PfamPF002496.2E-131461IPR001005SANT/Myb domain
CDDcd001679.21E-81661No hitNo description
PROSITE profilePS5129426.11662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.5E-2665116IPR009057Homeodomain-like
SMARTSM007173.7E-1666114IPR001005SANT/Myb domain
PfamPF002491.1E-1567112IPR001005SANT/Myb domain
CDDcd001672.08E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MGRAPCCAKE GLRKGPWSTK EDLLLTNYIK ENGEGQWRNL PNKAGLLRCG KSCRLRWMNY  60
LRPGIKRGNF SQDEDDLIIR LHSLLGNRWS LISGRLPGRT DNEIKNYWNT HLIKKLKIAG  120
IHPKVHKIFN KKEPKKKPKS DKPRKKQDKK KKNNKKKDQS LVNNNNNNDT PQVVFVPKPI  180
RLMRNYSVEM LSRPYQILKF NMHASALLKS QNNAASSSDN SEELAENNKK NINIITKDDE  240
NFLFDEFCDF SNESMVDKVY EEYLQLISEK CYDPMLM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-24121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133139PKKKPKS
2133151PKKKPKSDKPRKKQDKKKK
3134145KKKPKSDKPRKK
4134151KKKPKSDKPRKKQDKKKK
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1 or BHLH042/TT8. {ECO:0000269|PubMed:15361138}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754471e-112HG975447.1 Solanum pennellii chromosome ch08, complete genome.
GenBankHG9755201e-112HG975520.1 Solanum lycopersicum chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016552469.10.0PREDICTED: myb-related protein 308-like
SwissprotQ388506e-63MYB5_ARATH; Transcription repressor MYB5
TrEMBLA0A1U8F8A80.0A0A1U8F8A8_CAPAN; Transcription repressor MYB5
TrEMBLA0A2G3APA20.0A0A2G3APA2_CAPAN; myb-related protein 308-like
STRINGPGSC0003DMT4000149831e-126(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.12e-63myb domain protein 7
Publications ? help Back to Top
  1. Ranocha P,Francoz E,Burlat V,Dunand C
    Expression of PRX36, PMEI6 and SBT1.7 is controlled by complex transcription factor regulatory networks for proper seed coat mucilage extrusion.
    Plant Signal Behav, 2014. 9(11): p. e977734
    [PMID:25531128]