PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA01g07360
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 308aa    MW: 35118.3 Da    PI: 6.7001
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA01g07360genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.23.8e-181562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed++l d+++  G  +W +I+++ g++R++k+c++rw +yl
       CA01g07360 15 KGPWTPDEDKKLMDYITNNGHTNWQLIPKKAGLNRCGKSCRLRWTNYL 62
                     79********************************************97 PP

2Myb_DNA-binding51.91.8e-1668113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ eE+e+++ ++  lG++ W++Ia++++ gRt++++k++++++l
       CA01g07360  68 RGAFSFEEEEIIISLHSILGNK-WSRIASHLP-GRTDNEIKNFYNTHL 113
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.1421066IPR017930Myb domain
SuperFamilySSF466891.8E-2912109IPR009057Homeodomain-like
SMARTSM007172.8E-131464IPR001005SANT/Myb domain
PfamPF002493.2E-161562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-241669IPR009057Homeodomain-like
CDDcd001674.34E-101762No hitNo description
PROSITE profilePS5129419.85667117IPR017930Myb domain
SMARTSM007172.6E-1667115IPR001005SANT/Myb domain
PfamPF002498.5E-1568113IPR001005SANT/Myb domain
CDDcd001676.16E-1270113No hitNo description
Gene3DG3DSA:1.10.10.608.7E-2670117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MGRYPCFKVD EDLKKGPWTP DEDKKLMDYI TNNGHTNWQL IPKKAGLNRC GKSCRLRWTN  60
YLRPDIKRGA FSFEEEEIII SLHSILGNKW SRIASHLPGR TDNEIKNFYN THLRKKLLRL  120
GIDPRTHKPI SDLNFLINLS HQFPSKHNLF INNPLAYALK LQAQVTEIAK LQQLLQDLYA  180
PINTNIPLLP SNFQENNFAT SSSHVITTNV STNTHSLDSL LVNSCGTVLP NLNNSTSCNI  240
SNSSELSSYH QGELNSMTNT EADDIHVINQ DYDPNNTLSQ LNYDIPAWEK HHEDDDANSS  300
FWNDIFQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121174108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250|UniProtKB:Q9M2D9}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by gravity in roots. {ECO:0000269|PubMed:24902892}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016572882.10.0PREDICTED: transcription factor MYB39-like
SwissprotQ9SBF34e-68MYB92_ARATH; Transcription factor MYB92
TrEMBLA0A1U8GNQ40.0A0A1U8GNQ4_CAPAN; Transcription factor MYB39
TrEMBLA0A2G3AFJ70.0A0A2G3AFJ7_CAPAN; transcription factor MYB39-like
STRINGPGSC0003DMT4000451821e-144(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10280.14e-66myb domain protein 92
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]