PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA01g02130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 339aa    MW: 38576.7 Da    PI: 6.2801
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA01g02130genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.4e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++++ +G g+W+ ++++ g+ R++k+c++rw +yl
       CA01g02130 14 RGLWSPEEDEKLIRYITSHGYGCWSEVPEKAGLQRCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding53.36.2e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr+T+eE++l++ ++   G++ W+ Ia++++ gRt++++k++w+++
       CA01g02130  67 RGRFTPEEEKLIISLHGAVGNR-WAHIASHLP-GRTDNEIKNYWNSW 111
                      89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.4E-25663IPR009057Homeodomain-like
PROSITE profilePS5129417.638961IPR017930Myb domain
SuperFamilySSF466896.24E-3011108IPR009057Homeodomain-like
SMARTSM007173.8E-121363IPR001005SANT/Myb domain
PfamPF002494.0E-151461IPR001005SANT/Myb domain
CDDcd001672.24E-111761No hitNo description
PROSITE profilePS5129425.29662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2564117IPR009057Homeodomain-like
SMARTSM007171.2E-1666114IPR001005SANT/Myb domain
PfamPF002491.2E-1567111IPR001005SANT/Myb domain
CDDcd001676.02E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901430Biological Processpositive regulation of syringal lignin biosynthetic process
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MGHHSCCNQQ KVKRGLWSPE EDEKLIRYIT SHGYGCWSEV PEKAGLQRCG KSCRLRWINY  60
LRPDIRRGRF TPEEEKLIIS LHGAVGNRWA HIASHLPGRT DNEIKNYWNS WIKKKLKKPS  120
KPSANTTSIT DHHHQQSHQR SQLVNYNTIT SQQDIFFTQD LGTKSQVLLQ DSTLFNSPSQ  180
LFFFDSGSLD SMTNAIINDA TNRSTTTNNA SLFQETSTLN SEFCWQVDQQ QQQQLQVQTS  240
SYAIGMDSNY LPPLIESMVP PMEIPRNNNN NNNIMVEGQE NNNQLDEWSS QVDTQQCCPS  300
YLFWDQENGS IGGDHEINID PTTSNNMGQI LSSFPSSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25141167108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX952970.0X95297.1 L.esculentum mRNA for THM1 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016552744.10.0PREDICTED: transcription factor MYB86
TrEMBLA0A2G3ADP80.0A0A2G3ADP8_CAPAN; Protein ODORANT1
STRINGSolyc08g081500.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA124391722
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.11e-80myb domain protein 103