PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA01g00510
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 261aa    MW: 29811.9 Da    PI: 8.9493
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA01g00510genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.25.1e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+ +Ed ll ++++q+G g+W++ +   g+ R++k+c++rw +yl
       CA01g00510 14 KGPWSSQEDSLLTNYINQHGEGHWRSLPLNAGLLRCGKSCRLRWVNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding50.93.5e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++ ++Ed+l+v+++ +lG++ W++Ia +++ gRt++++k++w+++l
       CA01g00510  67 RGNFCEDEDDLIVRLHSLLGNR-WSLIAGRLP-GRTDNEIKNYWNTHL 112
                      78999*****************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.8E-21563IPR009057Homeodomain-like
PROSITE profilePS5129413.38961IPR017930Myb domain
SuperFamilySSF466891.91E-2811108IPR009057Homeodomain-like
SMARTSM007175.4E-111363IPR001005SANT/Myb domain
PfamPF002499.5E-131461IPR001005SANT/Myb domain
CDDcd001679.38E-81661No hitNo description
PROSITE profilePS5129424.80262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2464117IPR009057Homeodomain-like
SMARTSM007177.4E-1466114IPR001005SANT/Myb domain
PfamPF002491.5E-1467112IPR001005SANT/Myb domain
CDDcd001671.96E-1072112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MGRAPCCAKE GLRKGPWSSQ EDSLLTNYIN QHGEGHWRSL PLNAGLLRCG KSCRLRWVNY  60
LRPGIKRGNF CEDEDDLIVR LHSLLGNRWS LIAGRLPGRT DNEIKNYWNT HLVKKLKNTG  120
IDPKPLKNFP RRKKTQKEGK KCKSQNSKGQ SVQVEKIKVF APKPIRISCV NSRDNSFEND  180
TLSTSTCSSN SNFEEVDVGK EKENEVNFLA RDLDFGELLK GDEFCDEFLM GESFNFSKRP  240
FSLDDNMVEK VYQEYLLLLS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By nitrogen, salicylic acid, NaCl and abscisic acid (ABA). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:18541146, ECO:0000269|PubMed:9839469}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016552575.10.0PREDICTED: myb-related protein 308-like
SwissprotQ9S9K91e-63MYB3_ARATH; Transcription factor MYB3
TrEMBLA0A1U8FA380.0A0A1U8FA38_CAPAN; Transcription repressor MYB6
TrEMBLA0A2G3ADB00.0A0A2G3ADB0_CAPAN; myb-related protein 308-like
STRINGPGSC0003DMT4000316071e-145(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.11e-65myb domain protein 7
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zhou M, et al.
    Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis.
    Plant J., 2015. 84(2): p. 395-403
    [PMID:26332741]
  3. Wada T,Hayashi N,Tominaga-Wada R
    Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis.
    Plant Signal Behav, 2015. 10(11): p. e1089372
    [PMID:26339713]
  4. Wada T,Tominaga-Wada R
    CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression.
    Plant Sci., 2015. 241: p. 260-5
    [PMID:26706076]
  5. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]
  6. Zhou M, et al.
    LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis.
    Plant Physiol., 2017. 174(3): p. 1348-1358
    [PMID:28483877]
  7. Mondal SK,Roy S
    Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis.
    J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601
    [PMID:28490275]