PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Bv4_091180_ntuh.t1

Organism

Beta vulgaris

Taxonomic ID

161934

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta

Family

MYB_related

Protein Properties

Length: 45aa MW: 5212.91 Da PI: 9.4279

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Bv4_091180_ntuh.t1	genome	TBVR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	39.4	1.4e-12	14	45	1	32
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 rg WT+eEd +l +++q+G+++W++I++ g Bv4_091180_ntuh.t1 14 RGQWTPEEDNKLSSYIAQHGTRNWRLIPKNAG 45 89**************************9876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	2.1E-14	5	43	IPR009057	Homeodomain-like
SuperFamily	SSF46689	5.96E-10	8	43	IPR009057	Homeodomain-like
PROSITE profile	PS51294	17.866	9	45	IPR017930	Myb domain
Pfam	PF00249	1.1E-10	14	45	IPR001005	SANT/Myb domain
CDD	cd00167	1.32E-6	17	45	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 45 aa Download sequence Send to blast
MGRIPCCEKE NVKRGQWTPE EDNKLSSYIA QHGTRNWRLI PKNAG

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the DNA sequence 5'-CCAACC-3'. Regulates directly PME5, UND and GLOX1 (PubMed:21673079). Essential for tapetum development in anthers and microsporogenesis (PubMed:12848824, PubMed:21673079). Regulates the timing of tapetal programmed cell death (PCD) which is critical for pollen development. May act through the activation of UND, encoding an A1 aspartic protease (PubMed:21673079). Required for anther development by regulating tapetum development, callose dissolution and exine formation. Acts upstream of A6 and FAR2/MS2, two genes required for pollen exine formation (PubMed:17727613). Negatively regulates trichome endoreduplication and trichome branching (PubMed:12848824). {ECO:0000269\|PubMed:12848824, ECO:0000269\|PubMed:17727613, ECO:0000269\|PubMed:21673079}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002533727.2	2e-26	probable amino acid permease 7
Swissprot	Q9XHV0	3e-26	MYB80_ARATH; Transcription factor MYB80
TrEMBL	A0A0A0L7E4	2e-26	A0A0A0L7E4_CUCSA; Uncharacterized protein
STRING	XP_002533726.1	8e-27	(Ricinus communis)
STRING	Al_scaffold_0008_2049	2e-25	(Arabidopsis lyrata)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G56110.1	1e-28	myb domain protein 103

Publications ? help Back to Top
Li SF,Iacuone S,Parish RW Suppression and restoration of male fertility using a transcription factor. Plant Biotechnol. J., 2007. 5(2): p. 297-312 [PMID:17309685] Qian H, et al. Trace concentrations of imazethapyr (IM) affect floral organs development and reproduction in Arabidopsis thaliana: IM-induced inhibition of key genes regulating anther and pollen biosynthesis. Ecotoxicology, 2015. 24(1): p. 163-71 [PMID:25348600] Xiong SX, et al. The transcription factors MS188 and AMS form a complex to activate the expression of CYP703A2 for sporopollenin biosynthesis in Arabidopsis thaliana. Plant J., 2016. 88(6): p. 936-946 [PMID:27460657] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604] Li DD,Xue JS,Zhu J,Yang ZN Gene Regulatory Network for Tapetum Development in Arabidopsis thaliana. Front Plant Sci, 2017. 8: p. 1559 [PMID:28955355]