PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Bv2_034240_wzwm.t1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 170aa MW: 19694.6 Da PI: 5.1159 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 96.2 | 2.2e-30 | 109 | 167 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +dDgy+WrKYG+K+vk+s++pr+YYrC+ gCpvkk+ver+++d k+v++tYeg Hnhe Bv2_034240_wzwm.t1 109 VDDGYKWRKYGKKMVKNSPNPRNYYRCAVDGCPVKKRVERDRDDMKYVITTYEGYHNHE 167 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 7.6E-33 | 95 | 169 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 3.92E-28 | 102 | 169 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 32.053 | 104 | 169 | IPR003657 | WRKY domain |
SMART | SM00774 | 6.5E-35 | 109 | 168 | IPR003657 | WRKY domain |
Pfam | PF03106 | 6.8E-24 | 110 | 167 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 170 aa Download sequence Send to blast |
MTTTTTTTTF SSLESSGSDQ YFEAGADFEV SDFLTFEDWG GFEQQSMGYG EIQNIGYQGN 60 TDQFCTDVGG TSHIQNEEEN YNKSIRNGRD KKDVKERVAF RMKSEIDVVD DGYKWRKYGK 120 KMVKNSPNPR NYYRCAVDGC PVKKRVERDR DDMKYVITTY EGYHNHETPR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2ayd_A | 1e-26 | 97 | 169 | 2 | 74 | WRKY transcription factor 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00531 | DAP | Transfer from AT5G26170 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010669355.1 | 1e-126 | PREDICTED: probable WRKY transcription factor 50 isoform X2 | ||||
Swissprot | Q8VWQ5 | 2e-39 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
TrEMBL | A0A0K9R690 | 2e-71 | A0A0K9R690_SPIOL; Uncharacterized protein | ||||
STRING | XP_010669354.1 | 1e-117 | (Beta vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 2e-41 | WRKY DNA-binding protein 50 |
Publications ? help Back to Top | |||
---|---|---|---|
|