PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Bostr.5022s0092.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
|
||||||||
Family | SRS | ||||||||
Protein Properties | Length: 172aa MW: 19451.3 Da PI: 8.7648 | ||||||||
Description | SRS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF702 | 92.7 | 7.6e-29 | 6 | 62 | 5 | 61 |
DUF702 5 tasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaass 61 +++C+dCGnqakk+C+++RCRtCCks++f+C+th+kstWvpa++r++++q+++++ s Bostr.5022s0092.1.p 6 GKRCEDCGNQAKKECVYMRCRTCCKSKAFHCQTHIKSTWVPAYRRSNKHQTQTQPFS 62 579********************************************9887776655 PP | |||||||
2 | DUF702 | 82.3 | 1.2e-25 | 72 | 123 | 103 | 154 |
DUF702 103 sslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154 ++P+e+ss a frcv+vss+ddg+e++aYqt+v+igGhvf+GiL+dqGl++ Bostr.5022s0092.1.p 72 GHFPAELSSLADFRCVKVSSIDDGKEQYAYQTTVNIGGHVFRGILHDQGLDK 123 45***********************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05142 | 5.3E-25 | 6 | 61 | IPR007818 | Protein of unknown function DUF702 |
TIGRFAMs | TIGR01623 | 1.7E-28 | 9 | 50 | IPR006510 | Zinc finger, lateral root primordium type 1 |
Pfam | PF05142 | 1.4E-22 | 68 | 122 | IPR007818 | Protein of unknown function DUF702 |
TIGRFAMs | TIGR01624 | 4.2E-30 | 73 | 121 | IPR006511 | Lateral Root Primordium type 1, C-terminal |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 172 aa Download sequence Send to blast |
MMMIMGKRCE DCGNQAKKEC VYMRCRTCCK SKAFHCQTHI KSTWVPAYRR SNKHQTQTQP 60 FSTCVQIRTI PGHFPAELSS LADFRCVKVS SIDDGKEQYA YQTTVNIGGH VFRGILHDQG 120 LDKVMVDHHC NKNSNNYQEL LPPSTSSCPM IITSPFTDFM SGTQFSSVLR R* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). {ECO:0000269|PubMed:16740146}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Bostr.5022s0092.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY163777 | 1e-154 | AY163777.1 Arabidopsis thaliana hypothetical protein (F3K23.16) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001324104.1 | 1e-108 | SHI-related sequence3 | ||||
Refseq | NP_179735.1 | 1e-108 | SHI-related sequence3 | ||||
Swissprot | Q9SJT8 | 1e-109 | SRS3_ARATH; Protein SHI RELATED SEQUENCE 3 | ||||
TrEMBL | A0A1P8AZ48 | 1e-106 | A0A1P8AZ48_ARATH; SHI-related sequence3 | ||||
STRING | Bostr.5022s0092.1.p | 1e-127 | (Boechera stricta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM9188 | 26 | 38 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G21400.1 | 1e-111 | SHI-related sequence3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Bostr.5022s0092.1.p |