PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Bostr.15774s0334.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 221aa MW: 25636.8 Da PI: 10.0256 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 89 | 2.4e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ien + rqvtfskRr g++KKA+ELSvLCda+va ++fs++g+lyeyss Bostr.15774s0334.1.p 9 KKIENVTSRQVTFSKRRSGLFKKAHELSVLCDAQVAAVVFSQSGRLYEYSS 59 68***********************************************96 PP | |||||||
2 | K-box | 65.3 | 2.1e-22 | 85 | 170 | 11 | 96 |
K-box 11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 e+ ++l++e++++ k+i+ L+ R+l+G++L+s+s+ eLq++ +q+eksl+ +Rs+K el+ +q+e+l++ke+el +e k+L + Bostr.15774s0334.1.p 85 ERYLQELKKEMDRMVKKIDHLEVLRRKLMGQGLGSCSVAELQEIDTQIEKSLRLVRSRKAELYADQLEKLKQKERELLNERKRLCE 170 566899**************************************************************************999865 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.1E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.328 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 4.06E-32 | 3 | 78 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 9.16E-42 | 3 | 75 | No hit | No description |
PRINTS | PR00404 | 4.0E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.1E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.0E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.0E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 13.818 | 88 | 179 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 3.3E-21 | 89 | 171 | IPR002487 | Transcription factor, K-box |
Gene3D | G3DSA:3.30.70.890 | 6.3E-4 | 93 | 133 | IPR013750 | GHMP kinase, C-terminal domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009909 | Biological Process | regulation of flower development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 221 aa Download sequence Send to blast |
MVRGKIEIKK IENVTSRQVT FSKRRSGLFK KAHELSVLCD AQVAAVVFSQ SGRLYEYSSS 60 EMEKIIERYG KFSNDFFVAE RPQVERYLQE LKKEMDRMVK KIDHLEVLRR KLMGQGLGSC 120 SVAELQEIDT QIEKSLRLVR SRKAELYADQ LEKLKQKERE LLNERKRLCE EQIKERLMRP 180 VVPLTLQLIY DKGKTEGGGR TKHSSEVETD LFIGLPVTRL * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 7e-20 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 7e-20 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 7e-20 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 7e-20 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6bz1_A | 9e-20 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6bz1_B | 9e-20 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6bz1_C | 9e-20 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6bz1_D | 9e-20 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL42 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269|PubMed:21609362}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Bostr.15774s0334.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY141220 | 0.0 | AY141220.1 Arabidopsis thaliana MADS-box protein AGL71 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006281070.1 | 1e-136 | MADS-box protein AGL71 isoform X1 | ||||
Refseq | XP_023643169.1 | 1e-136 | MADS-box protein AGL71 isoform X1 | ||||
Swissprot | Q9LT93 | 1e-122 | AGL71_ARATH; MADS-box protein AGL71 | ||||
TrEMBL | R0GS21 | 1e-135 | R0GS21_9BRAS; Uncharacterized protein | ||||
STRING | Bostr.15774s0334.1.p | 1e-157 | (Boechera stricta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM78 | 28 | 413 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G51870.3 | 1e-123 | AGAMOUS-like 71 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Bostr.15774s0334.1.p |