PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Bostr.13083s0004.6.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 234aa MW: 26705.7 Da PI: 9.7893 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 89.5 | 1.8e-28 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 ri+n++ rqvtfskRr g+lKKA+ELS+LCdaev viifsstgkly+y+s Bostr.13083s0004.6.p 10 RIDNSTSRQVTFSKRRSGLLKKAKELSILCDAEVGVIIFSSTGKLYDYAS 59 8***********************************************86 PP | |||||||
2 | K-box | 80.7 | 3.4e-27 | 82 | 171 | 9 | 98 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 +++++ + +q+e++ L+++++ Lq+ +R+l+Ge+L+ ++ ++Lq+Le+qL +slk +R kK++l++++i+el +k + +q+e+++L+++ Bostr.13083s0004.6.p 82 NHASEIKFWQREVESLQQQLQYLQECHRKLIGEELSGMNANDLQNLEDQLVTSLKGVRLKKDQLMTDEIRELNRKGQIIQKEHQELQNM 170 688999********************************************************************************998 PP K-box 98 l 98 + Bostr.13083s0004.6.p 171 V 171 7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 8.0E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.665 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.7E-32 | 2 | 92 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.71E-42 | 2 | 79 | No hit | No description |
PRINTS | PR00404 | 1.8E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.9E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.2E-23 | 83 | 171 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 13.975 | 87 | 177 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0007584 | Biological Process | response to nutrient | ||||
GO:0048527 | Biological Process | lateral root development | ||||
GO:0071249 | Biological Process | cellular response to nitrate | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008134 | Molecular Function | transcription factor binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 234 aa Download sequence Send to blast |
MGRGKIVIRR IDNSTSRQVT FSKRRSGLLK KAKELSILCD AEVGVIIFSS TGKLYDYASN 60 SSMKTIIERY NKVKEEQHQL LNHASEIKFW QREVESLQQQ LQYLQECHRK LIGEELSGMN 120 ANDLQNLEDQ LVTSLKGVRL KKDQLMTDEI RELNRKGQII QKEHQELQNM VDIMRKENVK 180 LQKKVHGRTN AIEGNASLDP ISNGTETCAP PQLQLIQIQP PREKSITLGL QLS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 2e-19 | 1 | 82 | 1 | 81 | MEF2C |
5f28_B | 2e-19 | 1 | 82 | 1 | 81 | MEF2C |
5f28_C | 2e-19 | 1 | 82 | 1 | 81 | MEF2C |
5f28_D | 2e-19 | 1 | 82 | 1 | 81 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Required for root plasticity in response to nitrate, NO(3)(-). Promotes lateral root growth in a NRT1.1-dependent manner. {ECO:0000269|PubMed:15667327, ECO:0000269|PubMed:17148611, ECO:0000269|PubMed:9430595}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Bostr.13083s0004.6.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by nitrate in root cell culture, (PubMed:9430595, PubMed:17148611). In roots, seems induced by nitrogen (N) deprivation (e.g. nitrate free medium) but rapidly repressed by N re-supply (e.g. nitrate, glutamine and ammonium) (PubMed:16021502). Slight repression in shoots during nitrogen (N) deprivation. {ECO:0000269|PubMed:16021502, ECO:0000269|PubMed:17148611, ECO:0000269|PubMed:9430595}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK228244 | 0.0 | AK228244.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL14-69-G23. | |||
GenBank | BT005861 | 0.0 | BT005861.1 Arabidopsis thaliana At2g14210 gene, complete cds. | |||
GenBank | Z97057 | 0.0 | Z97057.1 Arabidopsis thaliana mRNA for MADS-box transcription factor. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002883829.2 | 1e-151 | MADS-box transcription factor ANR1 | ||||
Swissprot | Q9SI38 | 1e-152 | ANR1_ARATH; MADS-box transcription factor ANR1 | ||||
TrEMBL | R0HS97 | 1e-149 | R0HS97_9BRAS; Uncharacterized protein | ||||
STRING | Bostr.13083s0004.1.p | 1e-159 | (Boechera stricta) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G14210.1 | 1e-142 | AGAMOUS-like 44 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Bostr.13083s0004.6.p |
Publications ? help Back to Top | |||
---|---|---|---|
|