PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Brast07G228900.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
|
||||||||
Family | ARR-B | ||||||||
Protein Properties | Length: 250aa MW: 28431.6 Da PI: 8.8792 | ||||||||
Description | ARR-B family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 60 | 5.1e-19 | 199 | 248 | 1 | 51 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 kpr+ W+ eLH +F++av+++ G++kA Pk+i ++m+v+ +++e v SHLQ Brast07G228900.1.p 199 KPRVSWSVELHGQFLDAVNKI-GIDKAGPKKICDMMNVDHVSRESVGSHLQ 248 79*******************.***************************** PP | |||||||
2 | Response_reg | 95.8 | 1e-31 | 28 | 136 | 1 | 109 |
EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS Response_reg 1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 v+ vdD+++ +++l+ +l+k +y +v+ ++d+e al++l+ek+ +Dl+++D+ mp+mdG+ell++i e +lp+i+++a+++ e++ + Brast07G228900.1.p 28 VMAVDDDRICLMILEAILQKYKY-HVTKVRDAETALKILREKKgwYDLVITDLHMPEMDGFELLRQIGLEM-DLPVIMLSANDDTETVMKG 116 799********************.***************999999**********************6654.8****************** PP HHTTESEEEESS--HHHHHH CS Response_reg 90 lkaGakdflsKpfdpeelvk 109 +++Ga d+l+Kp+++e+l + Brast07G228900.1.p 117 IRYGACDYLVKPIQEEQLKH 136 *****************975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF52172 | 3.42E-39 | 24 | 152 | IPR011006 | CheY-like superfamily |
Gene3D | G3DSA:3.40.50.2300 | 9.7E-45 | 24 | 168 | No hit | No description |
SMART | SM00448 | 2.3E-35 | 26 | 138 | IPR001789 | Signal transduction response regulator, receiver domain |
PROSITE profile | PS50110 | 45.616 | 27 | 142 | IPR001789 | Signal transduction response regulator, receiver domain |
Pfam | PF00072 | 4.9E-28 | 28 | 136 | IPR001789 | Signal transduction response regulator, receiver domain |
CDD | cd00156 | 1.61E-32 | 31 | 142 | No hit | No description |
PROSITE profile | PS51294 | 10.805 | 196 | 249 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.05E-11 | 197 | 248 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.1E-18 | 197 | 248 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 1.0E-16 | 199 | 249 | IPR006447 | Myb domain, plants |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000160 | Biological Process | phosphorelay signal transduction system | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 250 aa Download sequence Send to blast |
MASLQLEKTP AKEAASGASQ KWPEGMRVMA VDDDRICLMI LEAILQKYKY HVTKVRDAET 60 ALKILREKKG WYDLVITDLH MPEMDGFELL RQIGLEMDLP VIMLSANDDT ETVMKGIRYG 120 ACDYLVKPIQ EEQLKHIWQH VFRRRPEARN HNVADHRVEG RIIAEGEQGA RSTCRKNSRN 180 KKNDGRDSNE SKQNSSKKKP RVSWSVELHG QFLDAVNKIG IDKAGPKKIC DMMNVDHVSR 240 ESVGSHLQV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1irz_A | 2e-16 | 195 | 248 | 1 | 54 | ARR10-B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}. | |||||
UniProt | Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Brast07G228900.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002453411.1 | 1e-84 | two-component response regulator ORR24 | ||||
Swissprot | A2X1N2 | 8e-82 | ORR24_ORYSI; Two-component response regulator ORR24 | ||||
Swissprot | Q6H805 | 8e-82 | ORR24_ORYSJ; Two-component response regulator ORR24 | ||||
TrEMBL | A0A0Q3H1J2 | 3e-96 | A0A0Q3H1J2_BRADI; Uncharacterized protein | ||||
STRING | Sb04g005580.1 | 5e-84 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP8147 | 34 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G31920.1 | 9e-70 | response regulator 10 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Brast07G228900.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|