PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Brast02G070700.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 229aa MW: 25866.3 Da PI: 7.4214 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 77.6 | 9.4e-25 | 12 | 61 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rien rqvtfskRr g++KKAeELS+LCdaev + +fs tgkl+ ++s Brast02G070700.1.p 12 RIENLAARQVTFSKRRRGLFKKAEELSILCDAEVGLAVFSATGKLFQFAS 61 8**********************************************986 PP | |||||||
2 | K-box | 46.6 | 1.4e-16 | 92 | 173 | 18 | 99 |
K-box 18 qqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 + + a+L++e+ + +R++ Ge+L+sL++++Lq Le++Le++l ++ ++K++ +l++i+ l +k +l een +L+++l+ Brast02G070700.1.p 92 DSNCARLREELAEASLWLRQMRGEELQSLNIQQLQALEKRLESGLGSVLKTKSQKILDEISGLERKRTQLIEENSRLKEQLQ 173 567889999999999999************************************************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.6E-32 | 3 | 62 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 27.179 | 3 | 63 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.83E-29 | 5 | 88 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.9E-25 | 5 | 25 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.81E-38 | 5 | 76 | No hit | No description |
Pfam | PF00319 | 5.4E-24 | 12 | 59 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.9E-25 | 25 | 40 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.9E-25 | 40 | 61 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 12.213 | 88 | 180 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.0E-14 | 93 | 172 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009266 | Biological Process | response to temperature stimulus | ||||
GO:0009910 | Biological Process | negative regulation of flower development | ||||
GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0048438 | Biological Process | floral whorl development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000900 | Molecular Function | translation repressor activity, nucleic acid binding | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 229 aa Download sequence Send to blast |
MAGKRERIAI RRIENLAARQ VTFSKRRRGL FKKAEELSIL CDAEVGLAVF SATGKLFQFA 60 SSSMNQIIDR YNSHSKILQR ADEPSQLDLH EDSNCARLRE ELAEASLWLR QMRGEELQSL 120 NIQQLQALEK RLESGLGSVL KTKSQKILDE ISGLERKRTQ LIEENSRLKE QLQVSKMEIQ 180 VVTDSPVVYE EGQSSESVTN TSYPRPPLDT EDSSDTSLRL GLPLFNSK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 4e-19 | 5 | 75 | 3 | 73 | MEF2C |
5f28_B | 4e-19 | 5 | 75 | 3 | 73 | MEF2C |
5f28_C | 4e-19 | 5 | 75 | 3 | 73 | MEF2C |
5f28_D | 4e-19 | 5 | 75 | 3 | 73 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00272 | DAP | Transfer from AT2G22540 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Brast02G070700.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF469307 | 0.0 | KF469307.1 Brachypodium distachyon MADS-box transcription factor 12 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010229795.1 | 1e-159 | MADS-box transcription factor 47-like isoform X1 | ||||
Refseq | XP_010230136.1 | 1e-159 | MADS-box transcription factor 47-like isoform X1 | ||||
Swissprot | Q5K4R0 | 1e-122 | MAD47_ORYSJ; MADS-box transcription factor 47 | ||||
TrEMBL | I1H8V0 | 1e-157 | I1H8V0_BRADI; Uncharacterized protein | ||||
STRING | BRADI1G72150.1 | 1e-149 | (Brachypodium distachyon) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1221 | 36 | 97 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 6e-80 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Brast02G070700.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|