PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Brast01G271100.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 133aa MW: 14426.2 Da PI: 8.6717 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 58.4 | 9.8e-19 | 21 | 55 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C+ C+tt+Tp+WR gp g ++LCnaCG++yrkk++ Brast01G271100.1.p 21 CVECRTTTTPMWRGGPTGRRSLCNACGIRYRKKRR 55 ********************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50114 | 12.861 | 15 | 51 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 3.9E-15 | 15 | 65 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 2.57E-13 | 18 | 55 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 6.3E-16 | 19 | 56 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 3.52E-13 | 20 | 56 | No hit | No description |
PROSITE pattern | PS00344 | 0 | 21 | 46 | IPR000679 | Zinc finger, GATA-type |
Pfam | PF00320 | 1.4E-16 | 21 | 55 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 133 aa Download sequence Send to blast |
MGSSDRKVDG IGVVEEGRRS CVECRTTTTP MWRGGPTGRR SLCNACGIRY RKKRRQDLGL 60 DQKEPPPQQQ QHNGEEAIIT AEVKDSTSNS NSSSGSSNLQ IVQERKLLMG VEEAALLLMT 120 LSSPPPSTFL HG* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Brast01G271100.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FP096226 | 5e-49 | FP096226.1 Phyllostachys edulis cDNA clone: bphyst038a02, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003567660.1 | 3e-77 | GATA transcription factor 23 | ||||
TrEMBL | I1HF65 | 7e-76 | I1HF65_BRADI; Uncharacterized protein | ||||
STRING | BRADI2G12590.1 | 1e-76 | (Brachypodium distachyon) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6721 | 28 | 54 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26930.1 | 3e-18 | GATA transcription factor 23 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Brast01G271100.1.p |