PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009145454.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | B3 | ||||||||
Protein Properties | Length: 108aa MW: 12208 Da PI: 8.4964 | ||||||||
Description | B3 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 61.8 | 1.1e-19 | 2 | 82 | 17 | 98 |
E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS B3 17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 lp + + ++g +++ k+++l +++g+sW+ ++ ++ ++g+y++++GW++F+++n+ gD +vF ++g+ ++++++ v+ XP_009145454.1 2 FLPVEAM-RCGALNQQCKEVKLVNKEGKSWTARFGFSESDGAYYISRGWRKFCRDNRCTNGDLFVFNVVGDGTTTPLLCVCP 82 6788887.6644456779*****************************************************9999**99996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01019 | 9.0E-8 | 1 | 84 | IPR003340 | B3 DNA binding domain |
PROSITE profile | PS50863 | 14.142 | 1 | 84 | IPR003340 | B3 DNA binding domain |
CDD | cd10017 | 3.38E-13 | 1 | 74 | No hit | No description |
Pfam | PF02362 | 1.5E-17 | 1 | 82 | IPR003340 | B3 DNA binding domain |
SuperFamily | SSF101936 | 1.59E-15 | 2 | 80 | IPR015300 | DNA-binding pseudobarrel domain |
Gene3D | G3DSA:2.40.330.10 | 2.3E-14 | 6 | 79 | IPR015300 | DNA-binding pseudobarrel domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 108 aa Download sequence Send to blast |
MFLPVEAMRC GALNQQCKEV KLVNKEGKSW TARFGFSESD GAYYISRGWR KFCRDNRCTN 60 GDLFVFNVVG DGTTTPLLCV CPERKECTEL LIKHFSRIDG SIASTSRN |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009145454.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC155346 | 1e-166 | AC155346.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH081N08, complete sequence. | |||
GenBank | AP011622 | 1e-166 | AP011622.1 Brassica rapa subsp. pekinensis DNA, chromosome: Linkage group A5, BAC clone: KBrB038I07, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009129830.1 | 2e-76 | PREDICTED: B3 domain-containing protein REM2-like | ||||
Refseq | XP_009145454.1 | 1e-76 | PREDICTED: B3 domain-containing protein REM2-like | ||||
TrEMBL | M4DVR9 | 2e-74 | M4DVR9_BRARP; Uncharacterized protein | ||||
TrEMBL | M4F4R3 | 5e-74 | M4F4R3_BRARP; Uncharacterized protein | ||||
TrEMBL | M4F4R4 | 4e-75 | M4F4R4_BRARP; Uncharacterized protein | ||||
STRING | Bra020613.1-P | 4e-75 | (Brassica rapa) | ||||
STRING | Bra036066.1-P | 9e-75 | (Brassica rapa) | ||||
STRING | Bra036068.1-P | 7e-76 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM204 | 22 | 261 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G00260.1 | 7e-14 | B3 family protein |