PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009145289.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | B3 | ||||||||
Protein Properties | Length: 125aa MW: 13959 Da PI: 8.2779 | ||||||||
Description | B3 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 62 | 9.8e-20 | 24 | 103 | 18 | 98 |
--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS B3 18 lpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 lp +++ + k + k+ +l +++g+sW+v l+++ ++g+y++t+GW++F+ +n+ + gD +vF ++g+ ++++++ v+ XP_009145289.1 24 LPVGATSSTALHK-QCKETILVNKEGNSWNVSLRFSESGGKYYITRGWRKFCLDNRCEIGDLFVFNVVGDGKTTPLMCVCP 103 3444444446665.5579999*************************************************99999999996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01019 | 6.6E-10 | 15 | 105 | IPR003340 | B3 DNA binding domain |
CDD | cd10017 | 3.53E-14 | 19 | 87 | No hit | No description |
SuperFamily | SSF101936 | 1.2E-16 | 19 | 99 | IPR015300 | DNA-binding pseudobarrel domain |
Gene3D | G3DSA:2.40.330.10 | 1.4E-15 | 21 | 107 | IPR015300 | DNA-binding pseudobarrel domain |
Pfam | PF02362 | 4.9E-18 | 26 | 103 | IPR003340 | B3 DNA binding domain |
PROSITE profile | PS50863 | 12.125 | 39 | 105 | IPR003340 | B3 DNA binding domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 125 aa Download sequence Send to blast |
MGLAGRTGAM SFFSFDYCFL AEHLPVGATS STALHKQCKE TILVNKEGNS WNVSLRFSES 60 GGKYYITRGW RKFCLDNRCE IGDLFVFNVV GDGKTTPLMC VCPERKECSE ILSKYLSRKS 120 SESST |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009145289.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC232577 | 7e-79 | AC232577.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrS012H21, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013745597.1 | 3e-75 | B3 domain-containing protein REM2-like | ||||
Refseq | XP_022553352.1 | 3e-75 | B3 domain-containing protein REM2-like | ||||
TrEMBL | M4ER79 | 1e-74 | M4ER79_BRARP; Uncharacterized protein | ||||
STRING | Bra031302.1-P | 2e-75 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM204 | 22 | 261 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G24680.1 | 5e-16 | B3 family protein |