PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009133936.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 164aa MW: 18311.9 Da PI: 9.6386 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 75.3 | 2.1e-23 | 5 | 61 | 4 | 60 |
YABBY 4 fssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaae 60 +++eq+Cy+ CnfCn +lavsvP +slf +vtvrCGhCt+l svn+a a q l+ XP_009133936.1 5 ATAAEQLCYIPCNFCNIVLAVSVPCSSLFDIVTVRCGHCTNLWSVNMAAALQSLSRP 61 5689*******************************************9999887654 PP | |||||||
2 | YABBY | 133.7 | 2.3e-41 | 80 | 153 | 98 | 170 |
YABBY 98 sekl.senedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 ++k+ s+ + + ++++ v+rPPekrqrvPsayn+fikeeiqrika+nPdishreafs+aaknWahfP+ihfgl XP_009133936.1 80 NTKIsSRISARTISEQRIVNRPPEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGL 153 333415556778888888******************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 3.2E-69 | 7 | 153 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 3.8E-8 | 97 | 146 | IPR009071 | High mobility group box domain |
Gene3D | G3DSA:1.10.30.10 | 1.0E-4 | 100 | 147 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009944 | Biological Process | polarity specification of adaxial/abaxial axis | ||||
GO:1902183 | Biological Process | regulation of shoot apical meristem development | ||||
GO:2000024 | Biological Process | regulation of leaf development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 164 aa Download sequence Send to blast |
MANSATAAEQ LCYIPCNFCN IVLAVSVPCS SLFDIVTVRC GHCTNLWSVN MAAALQSLSR 60 PNFQVTPYAM PEYGSSSRGN TKISSRISAR TISEQRIVNR PPEKRQRVPS AYNQFIKEEI 120 QRIKANNPDI SHREAFSTAA KNWAHFPHIH FGLMLESNKQ AKLA |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Promotes adaxial cell identity. Regulates the initiation of embryonic shoot apical meristem (SAM) development. {ECO:0000269|PubMed:19837869}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009133936.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK353291 | 0.0 | AK353291.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-24-G08. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009133935.1 | 1e-120 | PREDICTED: axial regulator YABBY 5 isoform X1 | ||||
Refseq | XP_009133936.1 | 1e-120 | PREDICTED: axial regulator YABBY 5 isoform X1 | ||||
Refseq | XP_013735000.1 | 1e-120 | axial regulator YABBY 5 | ||||
Refseq | XP_013735001.1 | 1e-120 | axial regulator YABBY 5 | ||||
Swissprot | Q8GW46 | 1e-111 | YAB5_ARATH; Axial regulator YABBY 5 | ||||
TrEMBL | A0A398A5C0 | 1e-119 | A0A398A5C0_BRACM; Uncharacterized protein | ||||
TrEMBL | M4C8L0 | 1e-119 | M4C8L0_BRARP; Uncharacterized protein | ||||
STRING | Bra000538.1-P | 1e-120 | (Brassica rapa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G26580.2 | 1e-114 | YABBY family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|