PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009132733.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 66aa MW: 7974.14 Da PI: 6.8113 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 26.8 | 1.2e-08 | 17 | 56 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 +T++E++l+ + ++ G++ W++Ia ++ gR++ ++ +w XP_009132733.1 17 MTEQEEDLISRMYRLVGNR-WDLIAGRVA-GRSASEIERYWI 56 7******************.*********.***********5 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 4.1E-6 | 13 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 8.85E-6 | 16 | 55 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.6E-10 | 17 | 56 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 5.7E-8 | 17 | 56 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.11E-7 | 18 | 56 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50090 | 6.121 | 18 | 55 | IPR017877 | Myb-like domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0080147 | Biological Process | root hair cell development | ||||
GO:1900033 | Biological Process | negative regulation of trichome patterning | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 66 aa Download sequence Send to blast |
MVLRLEVTSI KWEFINMTEQ EEDLISRMYR LVGNRWDLIA GRVAGRSASE IERYWIMKNN 60 DYFSNK |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in stomatal guard mother cells, young stomata and trichomes of young leaves, and inflorescences. {ECO:0000269|PubMed:15604688}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. {ECO:0000269|PubMed:15604688, ECO:0000269|PubMed:19818620}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009132733.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY234411 | 3e-42 | AY234411.1 Arabidopsis thaliana hypothetical protein (At2g30420) mRNA, complete cds. | |||
GenBank | AY519520 | 3e-42 | AY519520.1 Arabidopsis thaliana MYB transcription factor (At2g30420) mRNA, complete cds. | |||
GenBank | AY649255 | 3e-42 | AY649255.1 Arabidopsis thaliana hypothetical protein (At2g30420) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009132732.1 | 3e-38 | PREDICTED: MYB-like transcription factor ETC2 | ||||
Refseq | XP_013740419.1 | 3e-38 | MYB-like transcription factor ETC2 | ||||
Swissprot | Q84RD1 | 2e-33 | ETC2_ARATH; MYB-like transcription factor ETC2 | ||||
TrEMBL | A0A078GC02 | 9e-35 | A0A078GC02_BRANA; BnaC03g16910D protein | ||||
TrEMBL | A0A0D3B482 | 9e-35 | A0A0D3B482_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6A880 | 9e-35 | A0A3P6A880_BRAOL; Uncharacterized protein | ||||
STRING | Bo3g024610.1 | 2e-35 | (Brassica oleracea) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G30420.1 | 8e-36 | MYB_related family protein |