PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT2G30420.1

Common Name

ETC2, T6B20, T9D9

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB_related

Protein Properties

Length: 112aa MW: 13605.4 Da PI: 10.6484

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT2G30420.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	24.8	5.1e-08	40	79	4	45
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 +T++E++l+ + ++ G++ W++Ia ++ gR ++++ +w AT2G30420.1 40 MTEQEEDLISRMYRLVGNR-WDLIAGRVV-GRKANEIERYWI 79 79***************.*****.*********5 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00717	5.6E-5	36	84	IPR001005	SANT/Myb domain
CDD	cd00167	3.42E-5	39	78	No hit	No description
Pfam	PF00249	2.7E-7	40	79	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.45E-6	41	88	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	2.7E-10	41	79	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0080147	Biological Process	root hair cell development
GO:1900033	Biological Process	negative regulation of trichome patterning
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0005515	Molecular Function	protein binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000293	anatomy	guard cell

Sequence ? help Back to Top
Protein Sequence Length: 112 aa Download sequence Send to blast
MDNTNRLRLR RGPSLRQTKF TRSRYDSEEV SSIEWEFISM TEQEEDLISR MYRLVGNRWD 60 LIAGRVVGRK ANEIERYWIM RNSDYFSHKR RRLNNSPFFS TSPLNLQENL KL

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	88	92	KRRRL

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	186504269	0.0
Genevisible	267495_at	1e-115
Expression Atlas	AT2G30420	-
AtGenExpress	AT2G30420	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in stomatal guard mother cells, young stomata and trichomes of young leaves, and inflorescences. {ECO:0000269\|PubMed:15604688}.

Functional Description ? help Back to Top
Source	Description
TAIR	In a tandem repeat with AT2G30424 and AT2G30432
UniProt	MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. {ECO:0000269\|PubMed:15604688, ECO:0000269\|PubMed:19818620}.

Function -- GeneRIF ? help Back to Top
ETC2 is the major locus determining trichome patterning in natural Arabidopsis populations. [PMID: 19818620] Study compared the functions of the wild-type TRY and ETC2 proteins and their amino acid-substituted versions. Results showed that the substitution of amino acids in the C-terminal of TRY and ETC2 conferred them the ability to induce root hair formation. Furthermore, results confirmed that these mutations enhanced the stability of the TRY and ETC2 proteins. [PMID: 30308079]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT2G30420.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Interaction ? help Back to Top
Source	Intact With
IntAct	Search Q84RD1

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT2G30420

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY234411	0.0	AY234411.1 Arabidopsis thaliana hypothetical protein (At2g30420) mRNA, complete cds.
GenBank	AY519520	0.0	AY519520.1 Arabidopsis thaliana MYB transcription factor (At2g30420) mRNA, complete cds.
GenBank	AY649255	0.0	AY649255.1 Arabidopsis thaliana hypothetical protein (At2g30420) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_850145.1	1e-76	Homeodomain-like superfamily protein
Swissprot	Q84RD1	9e-78	ETC2_ARATH; MYB-like transcription factor ETC2
TrEMBL	D6C582	3e-74	D6C582_ARATH; Enhancer of triptychon and caprice 2
STRING	AT2G30420.1	4e-76	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM323	28	194
Representative plant	OGRP4207	8	23

Link Out ? help Back to Top
Phytozome	AT2G30420.1
Entrez Gene	817593
iHOP	AT2G30420
wikigenes	AT2G30420

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Xiao YL,Malik M,Whitelaw CA,Town CD Cloning and sequencing of cDNAs for hypothetical genes from chromosome 2 of Arabidopsis. Plant Physiol., 2002. 130(4): p. 2118-28 [PMID:12481096] Wu XM,Lim SH,Yang WC Characterization, expression and phylogenetic study of R2R3-MYB genes in orchid. Plant Mol. Biol., 2003. 51(6): p. 959-72 [PMID:12777054] Kirik V,Simon M,Huelskamp M,Schiefelbein J The ENHANCER OF TRY AND CPC1 gene acts redundantly with TRIPTYCHON and CAPRICE in trichome and root hair cell patterning in Arabidopsis. Dev. Biol., 2004. 268(2): p. 506-13 [PMID:15063185] Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes. Plant J., 2004. 38(2): p. 366-79 [PMID:15078338] Zimmermann IM,Heim MA,Weisshaar B,Uhrig JF Comprehensive identification of Arabidopsis thaliana MYB transcription factors interacting with R/B-like BHLH proteins. Plant J., 2004. 40(1): p. 22-34 [PMID:15361138] Kirik V,Simon M,Wester K,Schiefelbein J,Hulskamp M ENHANCER of TRY and CPC 2 (ETC2) reveals redundancy in the region-specific control of trichome development of Arabidopsis. Plant Mol. Biol., 2004. 55(3): p. 389-98 [PMID:15604688] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Schwab R,Ossowski S,Riester M,Warthmann N,Weigel D Highly specific gene silencing by artificial microRNAs in Arabidopsis. Plant Cell, 2006. 18(5): p. 1121-33 [PMID:16531494] Guimil S,Dunand C Patterning of Arabidopsis epidermal cells: epigenetic factors regulate the complex epidermal cell fate pathway. Trends Plant Sci., 2006. 11(12): p. 601-9 [PMID:17088095] Simon M,Lee MM,Lin Y,Gish L,Schiefelbein J Distinct and overlapping roles of single-repeat MYB genes in root epidermal patterning. Dev. Biol., 2007. 311(2): p. 566-78 [PMID:17931617] Dubos C, et al. MYBL2 is a new regulator of flavonoid biosynthesis in Arabidopsis thaliana. Plant J., 2008. 55(6): p. 940-53 [PMID:18532978] Jakoby MJ, et al. Transcriptional profiling of mature Arabidopsis trichomes reveals that NOECK encodes the MIXTA-like transcriptional regulator MYB106. Plant Physiol., 2008. 148(3): p. 1583-602 [PMID:18805951] Wester K, et al. Functional diversity of R3 single-repeat genes in trichome development. Development, 2009. 136(9): p. 1487-96 [PMID:19336467] Hilscher J,Schlötterer C,Hauser MT A single amino acid replacement in ETC2 shapes trichome patterning in natural Arabidopsis populations. Curr. Biol., 2009. 19(20): p. 1747-51 [PMID:19818620] Atwell S, et al. Genome-wide association study of 107 phenotypes in Arabidopsis thaliana inbred lines. Nature, 2010. 465(7298): p. 627-31 [PMID:20336072] Tominaga-Wada R,Nukumizu Y Expression analysis of an R3-Type MYB transcription factor CPC-LIKE MYB4 (TRICHOMELESS2) and CPL4-Related transcripts in Arabidopsis. Int J Mol Sci, 2012. 13(3): p. 3478-91 [PMID:22489163] Tominaga-Wada R,Nukumizu Y,Sato S,Wada T Control of plant trichome and root-hair development by a tomato (Solanum lycopersicum) R3 MYB transcription factor. PLoS ONE, 2013. 8(1): p. e54019 [PMID:23326563] Nukumizu Y,Wada T,Tominaga-Wada R Tomato (Solanum lycopersicum) homologs of TRIPTYCHON (SlTRY) and GLABRA3 (SlGL3) are involved in anthocyanin accumulation. Plant Signal Behav, 2013. 8(7): p. e24575 [PMID:23603939] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Wada T,Hayashi N,Tominaga-Wada R Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis. Plant Signal Behav, 2015. 10(11): p. e1089372 [PMID:26339713] Huang M,Hu Y,Liu X,Li Y,Hou X Arabidopsis LEAFY COTYLEDON1 controls cell fate determination during post-embryonic development. Front Plant Sci, 2015. 6: p. 955 [PMID:26579186] Wada T,Tominaga-Wada R CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression. Plant Sci., 2015. 241: p. 260-5 [PMID:26706076] Tominaga-Wada R,Wada T Extended C termini of CPC-LIKE MYB proteins confer functional diversity in Arabidopsis epidermal cell differentiation. Development, 2017. 144(13): p. 2375-2380 [PMID:28676568] Yamada K,Sasabe M,Fujikawa Y,Wada T,Tominaga-Wada R Amino acid substitutions in CPC-LIKE MYB reveal residues important for protein stability in Arabidopsis roots. PLoS ONE, 2018. 13(10): p. e0205522 [PMID:30308079]