PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009126701.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | WOX | ||||||||
Protein Properties | Length: 254aa MW: 28386.6 Da PI: 9.8366 | ||||||||
Description | WOX family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 63.9 | 2.3e-20 | 13 | 72 | 3 | 57 |
--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS Homeobox 3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 +R+++tkeq++ Le+l+++ r+psa+++++++ +l +++ ++V++WFqN++a++++ XP_009126701.1 13 SRWNPTKEQITLLENLYKEgIRTPSADQIQQITGRLrvhgHIEGKNVFYWFQNHKARQRQ 72 8*****************99**************************************97 PP | |||||||
2 | Wus_type_Homeobox | 113.8 | 8.7e-37 | 11 | 74 | 2 | 65 |
Wus_type_Homeobox 2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 +++RW+Pt+eQi++Le+lyk+G+rtP++++iq+it +L+ +G+ie+kNVfyWFQN+kaR+rqkq XP_009126701.1 11 SSSRWNPTKEQITLLENLYKEGIRTPSADQIQQITGRLRVHGHIEGKNVFYWFQNHKARQRQKQ 74 689***********************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50071 | 10.916 | 8 | 73 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 4.71E-12 | 8 | 79 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 5.5E-6 | 10 | 77 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 7.4E-8 | 13 | 72 | IPR009057 | Homeodomain-like |
Pfam | PF00046 | 4.8E-18 | 13 | 72 | IPR001356 | Homeobox domain |
CDD | cd00086 | 4.94E-6 | 14 | 74 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0008284 | Biological Process | positive regulation of cell proliferation | ||||
GO:0009942 | Biological Process | longitudinal axis specification | ||||
GO:0010654 | Biological Process | apical cell fate commitment | ||||
GO:0048825 | Biological Process | cotyledon development | ||||
GO:0080167 | Biological Process | response to karrikin | ||||
GO:0090451 | Biological Process | cotyledon boundary formation | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 254 aa Download sequence Send to blast |
MEKEGKVGTA SSSRWNPTKE QITLLENLYK EGIRTPSADQ IQQITGRLRV HGHIEGKNVF 60 YWFQNHKARQ RQKQKQERIA YFNRLLHKTS RFFRPPLCSN VGCVSPYYLQ QVGDHHNQHG 120 HGSVYRHSNN VMNPNGGYDK RTITDHKKQL SDITTTAARL SMSSSSLRFD RFALCDHGYN 180 GEDINVNSNG PKTLSLFPLQ PLDAASEDGV GNSKISPGRD SPVTCFGDGG GREQPFIDFF 240 SGGSSRFANG ANGL |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Detected in the egg cell and the central cell of the embryo sac, but not in the synergids, the antipodals or the male gametophyte. After fertilization, it is expressed in the zygote. After the first division of the zygote, it is detected exclusively in the apical daughter cell, while WOX8 is expressed in the basal daughter cell. Subsequently, it is expressed in all cells of the 4-cell embryo proper and predominantly in the apical domain of the 8-cell embryo. However, in some 8-cell embryos it is also weakly expressed in the central domain suggesting that expression shifts to the most apical cells during this stage. Expression remains restricted to the apical domain in the 16-cell embryo and the early-globular stage. Not expressed in the apical domain thereafter. However, in heart stage embryos it is weakly expressed in a ring of epidermal cells approximately at the junction of hypocotyl and root. Not expressed in mature embryos, endosperm or postembryonically in inflorescences. {ECO:0000269|PubMed:14711878}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in embryonic patterning. Required for apical embryo development after fertilization. Its specific localization to the apical daughter cell of the zygote, while WOX8 is confined to the basal cell, suggests that the asymmetric division of the plant zygote separates determinants of apical and basal cell fates. {ECO:0000269|PubMed:14711878}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009126701.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009126701.1 | 0.0 | PREDICTED: WUSCHEL-related homeobox 2-like | ||||
Swissprot | Q6X7K1 | 1e-139 | WOX2_ARATH; WUSCHEL-related homeobox 2 | ||||
TrEMBL | A0A398AF93 | 0.0 | A0A398AF93_BRACM; Uncharacterized protein | ||||
STRING | Bo2g026810.1 | 1e-180 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6914 | 28 | 44 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G59340.1 | 1e-126 | WUSCHEL related homeobox 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|