PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009120496.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 237aa MW: 27550.9 Da PI: 8.6919 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54.2 | 3.3e-17 | 10 | 57 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT++Ed llv+ v+ +G ++W+ +a+ g++Rt+k+c++rw +yl XP_009120496.1 10 KGPWTEQEDILLVNFVHAFGDRRWDFVAKVSGLNRTGKSCRLRWVNYL 57 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 52.7 | 9.7e-17 | 63 | 108 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T +E+ l +++++++G++ W++Ia++++ gRt++++k++w++++ XP_009120496.1 63 RGKMTHQEERLVLELHAKWGNR-WSKIAKKLP-GRTDNEIKNYWRTHM 108 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.201 | 1 | 57 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.8E-29 | 8 | 104 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.3E-15 | 9 | 59 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.5E-16 | 10 | 57 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.3E-20 | 11 | 64 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.49E-10 | 12 | 57 | No hit | No description |
PROSITE profile | PS51294 | 27.323 | 58 | 112 | IPR017930 | Myb domain |
SMART | SM00717 | 2.2E-16 | 62 | 110 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.1E-15 | 63 | 107 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.8E-23 | 65 | 111 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 9.79E-12 | 65 | 108 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 237 aa Download sequence Send to blast |
MKNVQEEYRK GPWTEQEDIL LVNFVHAFGD RRWDFVAKVS GLNRTGKSCR LRWVNYLHPG 60 LKRGKMTHQE ERLVLELHAK WGNRWSKIAK KLPGRTDNEI KNYWRTHMRK QAQEKKRPMS 120 PTSSSSNCCS SSMTQDTGGS NGKMNQECDD GNYSMDDIWR EIDQSGANII KPVKDIYYSE 180 QSCYFNFPPL PLASPTWESS LESTWNMDAY ESKMSSFAID QFPLSFEHAR SSWSSLV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 2e-28 | 7 | 112 | 1 | 105 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Mainly expressed in leaves and seedlings, and to a lower extent, in roots, stems and inflorescences. Isoform MYB59-1 and isoform MYB59-2 are present in roots, leaves, and seedlings, while the expression of isoform MYB59-3 and isoform MYB59-4 is confined to seedlings. {ECO:0000269|PubMed:16531467}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. {ECO:0000305}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009120496.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Isoform MYB59-1 is induced by jasmonate (JA), salicylic acid (SA), gibberellic acid (GA), and ethylene. Also induced by cadmium (Cd). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:16531467}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KC966740 | 0.0 | KC966740.1 Brassica napus MYB transcription factor 59 (MYB59.1) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009120496.1 | 1e-180 | PREDICTED: transcription factor MYB59 isoform X1 | ||||
Swissprot | Q4JL84 | 1e-147 | MYB59_ARATH; Transcription factor MYB59 | ||||
TrEMBL | M4CEA2 | 1e-179 | M4CEA2_BRARP; Uncharacterized protein | ||||
STRING | Bra002533.1-P | 1e-180 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2502 | 27 | 74 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G59780.3 | 1e-143 | myb domain protein 59 |
Publications ? help Back to Top | |||
---|---|---|---|
|